KEGG   Acidianus hospitalis: Ahos_2004Help
Entry
Ahos_2004         CDS       T01493                                 

Definition
(GenBank) precorrin-6Y C5,15-methyltransferase(decarboxylating), CbiT subunit
  KO
K02191  cobalt-precorrin-6B (C15)-methyltransferase [EC:2.1.1.196]
Organism
aho  Acidianus hospitalis
Pathway
aho00860  Porphyrin and chlorophyll metabolism
aho01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aho00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Ahos_2004
Enzymes [BR:aho01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.196  cobalt-precorrin-6B (C15)-methyltransferase [decarboxylating]
     Ahos_2004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_31 PCMT Cons_hypoth95 Methyltransf_25 Methyltransf_24 Methyltransf_3 MTS Ubie_methyltran PrmA DOT1 GidB Met_10 Methyltransf_4 Methyltransf_18 Methyltransf_15 GCD14 CMAS RrnaAD Methyltransf_11 Methyltransf_5 Methyltransf_12 Fibrillarin FtsJ Methyltransf_23 Methyltransf_16 PRMT5 Methyltr_RsmB-F UPF0020 DNA_methylase Methyltransf_32
Motif
Other DBs
NCBI-ProteinID: AEE94876
UniProt: F4B852
Position
complement(1817914..1818486)
Genome map
AA seq 190 aa AA seqDB search
MLGIPDEMFIRDEKIPMTKEEIRVLALSKAKLFHGAKFVDIGSGTGSVTVEAGLYVGSKG
KVYAVEKDPNAVELTRKNIEKFDLHNVTIIQGESPDALKEIREEVDAIFVGGSERLKDSL
VASNEILKKKGRIVLDAILLETAVKAMEVLNSMNYNPQIIEVIVAKGMKTSKGYAMLSRN
PIFIIYGEKP
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgttaggaattccagatgaaatgtttataagagatgaaaaaattcctatgactaaggag
gaaattagagtattagctttatctaaggctaagcttttccacggtgcaaaatttgtagat
attggtagcggaacagggagtgttacagttgaggcaggattatatgttggaagcaaaggt
aaagtttacgctgtagagaaagatcctaatgctgtagaattaactaggaaaaatatagaa
aaatttgatttacataatgtgactattatacaaggagaatctcctgatgctttaaaagaa
ataagggaagaagtagatgcaatatttgtaggtgggtctgaaagacttaaggacagtttg
gttgcttctaatgaaattctgaagaagaaagggagaatagtacttgatgcaatactgtta
gagactgcagtgaaagccatggaggttcttaattcaatgaattataatcctcaaataatc
gaggtaattgtggctaaaggaatgaaaacgtcgaagggatatgcaatgttgtctagaaat
cctattttcattatttacggtgagaagccttga

DBGET integrated database retrieval system