KEGG   Aeromonas hydrophila pc104A: V429_01450Help
Entry
V429_01450        CDS       T03193                                 

Definition
(GenBank) coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
ahp  Aeromonas hydrophila pc104A
Pathway
ahp00860  Porphyrin and chlorophyll metabolism
ahp01100  Metabolic pathways
ahp01110  Biosynthesis of secondary metabolites
Module
ahp_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:ahp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    V429_01450
Enzymes [BR:ahp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     V429_01450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C
Motif
Other DBs
NCBI-ProteinID: AHX67583
Position
311909..313282
Genome map
AA seq 457 aa AA seqDB search
MQAEQIVWDQALIEKYNYSGPRYTSYPTALEFNEGFGYPDFVQAASQYPARNLSLYVHIP
FCHKLCYYCGCNKVITRHRHKADQYLDFLEQEIKAQAPLFKQRLVTQLHWGGGTPTYLDE
PQTRRLMAMLREHFHFAEEGEISIEVDPREIELSMLDVLREIGFNRISLGVQDFNKEVQA
AVNREQDNDFIRAMLERARELGFRSTNLDLIYGLPHQNRESFHHTLEEVLKTDPARLSIF
NYAHLPSRFAAQHKLKEADMPAPQEKLAMLQDTIAFLTGRGYQFIGMDHFAKPDDELAVA
QREGKLHRNFQGYTTQGDCDLLGLGVSSISMIGDAYSQNQKELKAYYGQVETLGHAQWKG
CSLNQDDLIRREVIKRLICDFRLNFAAVEQAHGLVFREYFAEDLKLLQTFIDDGLVRMTE
EGLEVVSTGQLLIRNICMCFDVYLRNKARQQQFSRVI
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
gtgcaagcagaacagattgtgtgggatcaggccctgatcgagaagtataactacagcggt
ccgcgttacacctcctatcccaccgcgctggagttcaacgagggtttcggttatccggac
ttcgtccaggccgcgagccagtatccggcgcgcaacctgtcgctctacgtgcatatcccc
ttctgtcacaagctctgctactactgcggctgcaacaaggtgatcacccgtcaccgtcac
aaggccgatcagtacctcgatttcctcgagcaggagatcaaggcgcaggccccgctgttc
aagcagcggctggtgacccagctgcactggggcggcggcacgcccacctatctggatgaa
ccccagactcgccgactgatggccatgttgcgggagcattttcacttcgccgaagagggc
gaaatcagcatcgaggtggatccgcgcgagatcgagctctccatgctggacgtgctgcgg
gaaatcggcttcaaccgcatcagcctcggtgtgcaggacttcaacaaggaggtccaggcc
gcggtcaaccgcgagcaggacaatgacttcatccgcgccatgctggagcgggcccgcgaa
ctgggctttcgttccaccaacctggatctcatctacggtctgccgcaccagaaccgggag
agcttccatcacaccctggaagaggtgctcaagactgacccggcccgcctctccatcttc
aactatgcccacctgcccagccgttttgccgctcagcacaagctgaaagaggcggacatg
ccggcgccgcaggaaaaactggccatgctgcaggacaccatcgccttcctgaccggccgt
ggttatcagttcatcggtatggatcacttcgccaagccggacgacgagctggcagtggct
cagcgtgagggcaagctgcaccgcaacttccagggctataccactcagggggattgcgat
ctgctggggctgggggtctcctccatcagcatgatcggcgatgcctattcccagaaccag
aaagagctcaaggcctactatggccaggtggaaacgctggggcacgcccagtggaagggg
tgctctctcaatcaggacgacctgatccgccgggaggtgatcaagcgcctcatctgcgat
tttcgcctgaactttgccgccgtcgagcaggctcatggcctggtgttcagagagtacttt
gctgaggatctcaagctgctgcagaccttcatcgatgacggcctggtgcggatgaccgaa
gaggggctggaggtggtatccaccggtcagctgctgatccgcaacatctgcatgtgcttc
gatgtctacctgcgcaacaaggcgcgccagcagcagttctcccgggtgatctaa

DBGET integrated database retrieval system