KEGG   Aeromonas hydrophila pc104A: V429_06460Help
Entry
V429_06460        CDS       T03193                                 

Definition
(GenBank) protein-PII uridylyltransferase
  KO
K00990  [protein-PII] uridylyltransferase [EC:2.7.7.59]
Organism
ahp  Aeromonas hydrophila pc104A
Pathway
ahp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ahp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    V429_06460
Enzymes [BR:ahp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.59  [protein-PII] uridylyltransferase
     V429_06460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GlnD_UR_UTase HD ACT NTP_transf_2 ACT_4 DUF294 GlnE Polbeta
Motif
Other DBs
NCBI-ProteinID: AHX68527
Position
complement(1366009..1368663)
Genome map
AA seq 884 aa AA seqDB search
MDASLLSPHLLPDAQLSRENCKEYLSRFLGWLHARFDAGDNIIELVATRSEYMDELLTRL
WQKFGFDKTELTLIAVGGYGRGELHPHSDIDLLILYEGDELDEVLGLRIGEFITLLWDLK
LEVGQAVRNVAECLEQGRGDITIATNLIEARYITGREAGFQQLKEATGPQHFWPSEQFFK
AKREEQAQRHQQFLGTAYKLEPDLKSNPGGLRDIQTLAWVARRHFGATTLFEMTSHGFLN
RAEYRELLDCQNFLWKVRFALHMAINKGDNRLLFDRQRTVAQMLGFEGEGNAPVEQMMKR
FYQTVRRVSELNEMLLQLFDEAILGNTAMDVRRLSDEFQLRGRLIDAVDSELFGREPAAI
LRLFYQIAQHPEIAGIHSATLRQLREARRKLNCWLQDLPECRRLFMALLRHPNGIGQPLT
LMHKYGILAAYLPQWNLIVGQMQFDMFHAYTVDEHTHRLLKNIHQFPNPASRQTHPLCHE
VFTRLRKPELLSIAALFHDIAKGRRGDHSELGAVDALEFCQLHGLDRYESRLVAWLVRHH
LLMSVTAQRRDIYDPEVVTDFAQKVRDEQHLDLLYCLTVADICATNDTLWNDWKGTLLRE
LYFATQKALRQGLENPPDMRLKIRENQRQAKQILAQRDVPEEAINQLWSDFKADYFLRHT
PEQIAWHCRKIIEHGDNPAPLVIIGKHPTRGGSEVFIYCRDTPNLFATVASALDQKNLNI
HDAQIMNSRSDYVLDTFVVLEPNGEPISPNRTATIKKALEKALQEPGKLVLRSKPLSRRH
RQFSVPTRVVFLPHKGETRHTLLELTALDTPGLLARIGAVFQQCGLSLHAAKITTIGERV
EDFFSLTTLAGEPLTQAEQQALEERLVNQLNPQESGDDEGRPGP
NT seq 2655 nt NT seq  +upstreamnt  +downstreamnt
atggatgccagcctgctttccccccacctgttacccgacgctcagctcagccgcgagaac
tgcaaggagtacctgagccgttttctcggctggctgcacgcccgcttcgatgccggtgac
aacatcatcgaactggtggctacccgctccgaatacatggacgagctactgacccggttg
tggcaaaagtttggcttcgacaagacggagctcaccctgatcgcggtgggtggctatggc
cgtggcgaactgcacccccactccgacatcgacctgctgatcctctacgaaggggacgag
ctggacgaggtgctggggctgcgcatcggcgaattcatcaccctgctgtgggatctcaag
ctggaggtggggcaggcggtgcgcaacgtggccgagtgcctcgagcagggacgtggcgac
atcacgatcgccaccaacctcatcgaggcgcgctacatcaccggccgcgaggcgggcttc
cagcagctcaaggaggccaccggcccccagcacttctggccaagcgagcagttcttcaag
gcaaaacgcgaagagcaggcccagcgccaccagcagtttctcggcaccgcctacaagctg
gaaccggatctcaagagcaatccgggcggcctgcgcgacatccagaccctggcctgggtg
gctcgccgccacttcggcgccaccaccctgttcgaaatgaccagccacggcttcctcaat
cgggccgagtaccgcgaactgctcgattgccagaactttctgtggaaggtgcgcttcgcc
ctgcacatggccatcaacaagggcgacaaccggctgctgttcgatcgccagcgtaccgtg
gcccagatgctgggcttcgagggagaaggcaacgccccggtcgagcagatgatgaagcgc
ttctaccagactgtgcggcgggtctccgagctcaacgagatgctgctgcagctgtttgac
gaggcgatcctcggcaacaccgccatggacgtgcgtcgcctctctgacgagttccagctg
cgcggccgcctcatcgatgcggtggattccgaactgttcggccgcgagcccgctgccatc
ctgcgcctcttctaccagatagcccagcacccagagattgccggcatccattccgcaacc
ctgcgccagctgcgcgaggcgcgccgcaagctcaactgctggctgcaggacctgccggaa
tgccgccgcctgttcatggcgctgctgcgccatcccaacggcatcggccagccgctcacc
ctgatgcacaagtacggcatcctggccgcctacctgccccagtggaacctcatcgtcggc
cagatgcagttcgacatgttccacgcctacacggtggatgaacacacccaccggctgcta
aagaacatccaccagtttcccaacccggccagccgtcagacccacccgctctgccacgag
gtgttcacccggctgcgcaagccggagctgctcagcatcgccgccctgttccacgacatc
gccaaggggcggcgtggcgaccactcagagctcggcgctgtcgatgcgctggagttctgc
cagctgcacggcctggatcgctacgagagccggctggtcgcctggctggtacgccatcac
ctgctgatgtcggtcaccgcccagcgccgcgacatctatgaccctgaagtggtcaccgac
tttgcccagaaggtgcgcgacgagcagcacctcgacctgctttactgcctgaccgtggcc
gatatctgcgccaccaacgacaccctctggaacgactggaaaggcaccctgctgcgcgag
ctctacttcgccacccagaaggcgctgcgccaggggctggaaaatccgcccgacatgcgt
ctcaagatccgcgagaatcagcgccaggccaagcagatcctggctcagcgcgacgtgccg
gaggaggccatcaaccagctctggagcgacttcaaggccgactacttcctgcgccacacg
ccggagcagatcgcctggcactgccgcaagatcatcgaacacggcgacaacccggcgccg
ctggtgatcatcggcaagcacccgacccgcggcggcagcgaggtgttcatctattgccgc
gacaccccgaacctgttcgccaccgtggcctcggcgctggatcagaagaacctcaacatc
cacgacgcccagatcatgaattcgcgcagcgactacgtgctcgataccttcgtggtgctc
gagcccaacggcgagcccatcagccccaaccgcaccgccaccatcaagaaggcgctggag
aaggcgctgcaggagccgggcaagctggtgctgcgcagcaagcccctgtcacggcgccac
cgccagttcagcgtgccgacccgggtggtctttctgccccacaagggggagacccgccac
accctgctggagctgaccgcgctcgataccccggggctgctggcccgcatcggcgccgtg
ttccagcagtgcggcctgtcgctccatgccgccaagatcaccaccatcggcgagcgggtg
gaggactttttcagcctcaccaccctggccggcgagccgttgacccaggccgagcagcag
gcgctggaggagcggctggtcaaccagctcaacccgcaagagtcgggcgatgatgagggc
aggccgggcccgtga

DBGET integrated database retrieval system