KEGG   Aeromonas hydrophila pc104A: V429_12515
Entry
V429_12515        CDS       T03193                                 

Definition
(GenBank) xanthine dehydrogenase
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
ahp  Aeromonas hydrophila pc104A
Pathway
ahp00230  Purine metabolism
ahp01100  Metabolic pathways
ahp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ahp00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    V429_12515
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: AHX69674
Position
complement(2699213..2699698)
AA seq 161 aa
MMQPQSCPTVAIQCEINGKPYSYAVSPTMSLLHFLRGQGLISVKEGCSVGECGACTVRVN
GTAIDSCLYLAVWADGKSIRTVEGERQGNELSDVQQAFIDEGAVQCGFCTPGLVMASAAL
LDKTERRPLTDAEIRRGLSGNLCRCTGYQNVVRAVKKCCKG
NT seq 486 nt   +upstreamnt  +downstreamnt
atgatgcaaccgcaaagctgtcccactgttgcgatccagtgcgagatcaacggcaaaccc
tactcctacgcggtgtcgcccaccatgtcgctgctccacttcctgcgcgggcaggggctt
atcagcgtaaaagaggggtgcagtgtcggcgagtgcggcgcctgtaccgtgcgggtgaac
ggcacggccatcgacagctgtctttatctggcggtgtgggccgatggcaaatccattcgc
accgtggagggggagcggcagggcaatgagctatccgacgtgcagcaggcctttatcgac
gagggggcggtgcagtgcggcttttgcacgcctggcctcgtgatggcgagcgcagccctg
ctcgacaagaccgaacgccgtccgctgactgatgcggagatccgccgcgggctgtcgggg
aatctgtgccgctgtaccggttaccagaacgtggtgcgggcggtgaagaagtgctgcaag
gggtga

DBGET integrated database retrieval system