KEGG   Aeromonas hydrophila pc104A: V429_12735Help
Entry
V429_12735        CDS       T03193                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ahp  Aeromonas hydrophila pc104A
Pathway
ahp00071  Fatty acid degradation
ahp00072  Synthesis and degradation of ketone bodies
ahp00280  Valine, leucine and isoleucine degradation
ahp00310  Lysine degradation
ahp00362  Benzoate degradation
ahp00380  Tryptophan metabolism
ahp00620  Pyruvate metabolism
ahp00630  Glyoxylate and dicarboxylate metabolism
ahp00640  Propanoate metabolism
ahp00650  Butanoate metabolism
ahp00900  Terpenoid backbone biosynthesis
ahp01100  Metabolic pathways
ahp01110  Biosynthesis of secondary metabolites
ahp01120  Microbial metabolism in diverse environments
ahp01130  Biosynthesis of antibiotics
ahp01200  Carbon metabolism
ahp01212  Fatty acid metabolism
ahp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ahp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    V429_12735
   00630 Glyoxylate and dicarboxylate metabolism
    V429_12735
   00640 Propanoate metabolism
    V429_12735
   00650 Butanoate metabolism
    V429_12735
  09103 Lipid metabolism
   00071 Fatty acid degradation
    V429_12735
   00072 Synthesis and degradation of ketone bodies
    V429_12735
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    V429_12735
   00310 Lysine degradation
    V429_12735
   00380 Tryptophan metabolism
    V429_12735
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    V429_12735
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    V429_12735
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    V429_12735
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ahp04147]
    V429_12735
Enzymes [BR:ahp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     V429_12735
Exosome [BR:ahp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   V429_12735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AHX69712
Position
complement(2752728..2753891)
Genome map
AA seq 387 aa AA seqDB search
MDIVIVAAKRTPMGAFQGALANLTAPELGACAIAAAMAEAGLRGEQVDEAYLGNVLSAGV
GQAPARQAVLKAGLPDSIPCTTVSKVCGSGMKAVMLAADGLRLGDTKVVIAGGMESMSRA
PYLLDKARSGFRMGHQSVLDHMFLDGLQDAYEGQLMGHYAQLSADRAGLTRADMDAFAIA
SLERALAAQRSGAFAAELAPVMAGDTLLLAEDEQPAKARPEKIPQLKPAFSKTGTITAAN
ASSISDGAAALILMRSDTAVQLGLPVLARLVGYQSHAALPAEFTSAPVGAIKGLLAKVGW
RVEEVDLFEVNEAFAMVSLLAMAGCQLPHDKVNVNGGACALGHPLGASGARILVTLIHAL
RERGLTRGVASLCIGGGEATAVAIELG
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggatatcgtgattgttgcggccaaacgtacccccatgggggccttccagggagccctg
gccaacctgacggcacctgaactgggggcctgtgccattgccgcggccatggcagaagcg
gggctcaggggagagcaggtcgatgaagcctatctgggcaacgtgctgagtgccggggtc
ggccaggcacccgcccgccaggcggtgctgaaggcgggtctgccggacagcatcccctgc
accacggtcagcaaggtgtgcggttccggcatgaaggcggtgatgctggcggccgatggc
ttgcggctcggcgataccaaggtggtgatcgccggcgggatggagagcatgagccgcgcc
ccatatcttctggacaaggcgcgcagtggttttcggatggggcaccagagcgtgctcgat
cacatgttcctcgacggactgcaggatgcctacgaaggccagctgatggggcattatgcc
cagctgagcgccgatcgcgccggactgacccgtgccgacatggatgcctttgccatcgca
tcgctggagcgggcgctggcggcccagcgcagcggtgcctttgcggcggagctggcgcct
gtgatggccggagataccctgctgctggccgaggatgagcagcctgccaaggccaggccc
gagaagatcccccagctcaagcctgccttcagcaagacgggcaccatcacggcggccaat
gccagctccatctcggacggggcggcggcgctgatcctgatgcgctccgacactgccgtg
cagctgggactgccggtgctggcgcgactggtgggttatcagagccacgcggccctgccc
gccgagtttaccagcgcaccggtaggggccatcaagggcctgctggccaaggtgggttgg
cgggtggaggaggtggatctgttcgaggtcaacgaggcgtttgccatggtcagcctgctg
gcgatggccggttgccagctgccccatgacaaggtcaacgtgaacggcggcgcctgcgcg
ctgggtcatccgctgggggcgagtggtgccaggatcctggtgaccctgatccatgccctg
cgcgaacgcggtctcacacgcggggtggccagtctgtgtatcgggggcggggaggcgacg
gcggtcgccatcgagctgggttaa

DBGET integrated database retrieval system