KEGG   Aeromonas hydrophila pc104A: V429_15610Help
Entry
V429_15610        CDS       T03193                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
ahp  Aeromonas hydrophila pc104A
Pathway
ahp00730  Thiamine metabolism
ahp00790  Folate biosynthesis
ahp01100  Metabolic pathways
ahp02020  Two-component system
Module
ahp_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ahp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    V429_15610
   00790 Folate biosynthesis
    V429_15610
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    V429_15610
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ahp04147]
    V429_15610
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ahp00537]
    V429_15610
Enzymes [BR:ahp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     V429_15610
Exosome [BR:ahp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   V429_15610
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ahp00537]
 Enzymes
  V429_15610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Sulfatase Metalloenzyme
Motif
Other DBs
NCBI-ProteinID: AHX70232
Position
3409087..3410481
Genome map
AA seq 464 aa AA seqDB search
MNQSMKQNLHKTLVSTALLAALGGAAQAQASDAKNVILFIGDGMGPTVLTATRLYKVGEE
GNLEMMKLARSARIKTFSNDAQTTDSAPSMAAYTTGVKMNNEVIAMSSDTKAIAPGKDAN
GNKGVNNCASDNGKPVPTILELAKAAGKSVGAVTTTELTHATPAATYSHICHRDAAYAIA
EQAVPGGAGFNQALGDGVDVLMGGGANHWTPYNSTSNKGGRADGRDLTAELTAQGYRYVT
TKDDLAGVNSGKVLGLFSAKSHLDYELDRVAKGAANTQPSLSEMTAKAIDLLSQNSQGYF
LMVEGGRIDHALHGTNAKRSLTDAVALDEAVKTALGKVDLKDTLIVVTADHDHTMTINGY
SAKGNKVLDLVKNGDGSTQNDVDGKPFTTLVFGNGPNRPDVRPTLTSDQVMADDYLQETG
VKLGSETHGGGDVMLFADGAGSSRFKGTLDNTKVFGKLKEALGL
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atcaaccaatccatgaaacagaacctgcataaaaccctggtcagcacggccctgctggcc
gccctcggcggcgcggcccaggcacaggccagcgacgccaagaacgtcatcctgtttatc
ggcgacggcatgggccccaccgtgctcaccgccacccgcctctacaaggtgggggaggag
ggcaatctggagatgatgaagctggctcgcagcgcccgcatcaagaccttctccaacgat
gcccagaccaccgactcggccccctccatggcggcctacaccaccggggtcaagatgaac
aacgaggtgatcgccatgagcagcgacaccaaagccatcgcgcccggcaaggacgccaac
ggcaacaagggcgtcaacaactgcgccagcgacaacggcaagccggtgcccaccatcctg
gagctggccaaggcggcaggcaaatcggtcggggccgtcaccaccaccgagctgacccat
gccaccccggccgccacctactcccacatctgccatcgggatgccgcctacgccattgcc
gagcaggcggtaccgggcggcgccggcttcaaccaggcgctgggggacggggtcgacgtg
ctaatggggggcggcgccaaccactggacgccctacaacagcaccagcaacaagggtggc
cgcgccgacggacgggatctcaccgccgagctgaccgctcagggctatcgctacgtcacc
accaaagatgatctggctggcgtcaactcgggcaaggtgcttgggctgttcagcgccaaa
tcccacctcgactacgagctggaccgcgtcgccaagggggcggccaatacccagccgtcg
ctctccgagatgaccgccaaggcgatcgatctgctcagccagaacagccagggttatttc
ctgatggtggaagggggccgcattgaccacgccctgcacggcaccaatgccaagcgctcg
ctcaccgatgcggtagcactggacgaggcggtcaagacggcgctcggcaaggtggatttg
aaagataccctgatcgtggtcaccgccgaccatgaccacaccatgaccatcaacggctac
tccgccaagggcaacaaggtgctggatctggtgaaaaatggcgatggctcgacccagaac
gacgtggatggcaagccgtttaccaccctggtgttcggcaacggccccaaccgtcccgac
gtgcgccccaccctcaccagcgatcaggtgatggcggacgactacctgcaggagaccggg
gtcaagctcggctccgagacccacggtggcggcgatgtcatgctgttcgccgacggtgcc
ggcagcagccgcttcaaaggcacgctggataacacaaaggtgttcggcaagctcaaggag
gcgctcggcctgtaa

DBGET integrated database retrieval system