KEGG   Aeromonas hydrophila pc104A: V429_18745Help
Entry
V429_18745        CDS       T03193                                 

Definition
(GenBank) molybdopterin adenylyltransferase
  KO
K03831  molybdopterin adenylyltransferase [EC:2.7.7.75]
Organism
ahp  Aeromonas hydrophila pc104A
Pathway
ahp00790  Folate biosynthesis
ahp01100  Metabolic pathways
ahp04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:ahp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    V429_18745
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    V429_18745
Enzymes [BR:ahp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.75  molybdopterin adenylyltransferase
     V429_18745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MoCF_biosynth
Motif
Other DBs
NCBI-ProteinID: AHX70801
Position
4093863..4094393
Genome map
AA seq 176 aa AA seqDB search
MSKARIGIVTVSDRASAGIYEDLSGKAIIDTLNAYLTSAWEPVYQVIPDEQEQIEATLIR
LADQEQCSLIVTTGGTGPAKRDVTPEATEAVCDRMMPGFGELMRAESLKFVPTAILSRQT
AGLRGSSLIVNLPGKPKSIRECLDAVFPAIPYCIDLMEGPYLECDETVIKPFRPKK
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggcaagaatcggtatcgtcaccgtcagcgatcgcgccagtgcaggcatctac
gaagacctgtccggcaaggccatcatcgacacgctgaacgcatatttgacctcggcgtgg
gagcccgtctatcaggtgatccccgatgaacaggagcagatcgaagcgaccctgatccgg
ctggcggaccaggagcagtgcagcctcatcgtcaccaccggcggcaccgggccggccaag
cgggacgtcaccccggaggccaccgaggcggtgtgcgatcgcatgatgccgggctttggc
gagctgatgcgggccgaatccctcaagttcgtgccgaccgccatcctgtcacgccagacc
gccggcttgcgcggcagctcgctcatcgtcaacctgccgggcaagccgaagtcgatccgc
gagtgcctggatgcagtcttccccgccatcccctactgcatcgacctgatggaaggcccc
tatctcgagtgcgacgagaccgtcatcaagccgttccgtccgaagaaataa

DBGET integrated database retrieval system