KEGG   Aeromonas hydrophila AL09-71: V428_00895Help
Entry
V428_00895        CDS       T03192                                 

Definition
(GenBank) phosphopantothenoylcysteine decarboxylase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
ahr  Aeromonas hydrophila AL09-71
Pathway
ahr00770  Pantothenate and CoA biosynthesis
ahr01100  Metabolic pathways
Module
ahr_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:ahr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    V428_00895
Enzymes [BR:ahr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     V428_00895
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     V428_00895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein adh_short_C2 PspC
Motif
Other DBs
NCBI-ProteinID: AHX30690
Position
complement(200784..201986)
Genome map
AA seq 400 aa AA seqDB search
MRLADKRILLGVSGGIAAYKSAELVRRLKDQGAEVRVVMTRSAKEFITPLTLQAVSGHPV
ADSLLDPAAEAGMGHIELAKWADLVLIAPASANLMARMAAGMADELLTTLCLATPAPVAL
APAMNQQMYLNAATQANLKTLASRGILLWGPDSGSQACGDVGPGRMLDPLELVERCCQQL
AAEPLLAGVRLLLTAGPTREALDPVRYISNHSSGKMGYAIARAAREAGAEVTLVSGPVAL
ATPAGVTRVDVESAEQMHQAVMSRVGECDLFIGCAAVADYRPAQVANQKIKKTGDNDQMQ
LTLVKNSDIIAAVGALSDKPFTVGFAAETVDVEQYALDKLQRKRLDMIAANDVSRAGQGF
NADDNALTVFWQGGQAPLPLADKLTLARHLIALIADHYRH
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgagattggccgataaacgcatcctgttgggtgtcagtggcgggatcgccgcctacaag
agtgccgaactggtacgccgcctgaaagatcagggggccgaggtacgggtggtgatgacc
cgttccgccaaggaattcatcaccccgctgaccctgcaggccgtctccggccacccggtg
gccgacagtctgctggatccggccgccgaggcgggcatgggtcacatcgagctggccaag
tgggccgatctggtgctgatcgccccggccagcgccaacctgatggcccgcatggccgcc
ggcatggccgatgagctgctcaccaccctctgcctggccaccccggcaccggtggcgctg
gcgcccgccatgaaccagcagatgtatctcaacgccgccacccaggccaacctcaagact
ctggccagccgcggcatcctgctgtgggggccggattccggcagccaggcgtgcggtgac
gtaggcccgggccggatgctggatcccctcgagctggttgagcgctgctgtcagcagctc
gccgccgagccgctgctggcgggtgtcagactgctgctcaccgccgggccaacccgcgag
gcgctggatccggtgcgctacatcagcaaccacagctccggcaagatgggctacgccatc
gcccgcgccgcccgtgaagcgggcgccgaggtgaccctggtgagcggcccggtggcactg
gccaccccggcgggcgtcacccgtgtcgatgtggaaagtgccgaacagatgcatcaggcg
gtgatgagccgggtcggcgagtgcgatctcttcatcggctgcgccgccgtcgccgactac
cgccccgcgcaggtggccaaccagaagatcaagaagaccggtgacaacgaccagatgcag
ctgaccctggtcaagaactccgacatcatcgccgccgtgggggccttgtcagacaaaccc
ttcaccgtcggatttgccgcagaaaccgtggatgtggaacaatacgccctcgacaaactg
cagcgtaagcggctggacatgatcgccgccaacgacgtatctcgtgcgggccagggcttc
aacgccgatgacaacgccctgaccgtgttctggcaagggggccaagcacccctgcccctg
gccgataagctgacgctggctcgtcatctcatcgccctgattgcagaccactaccggcac
tga

DBGET integrated database retrieval system