KEGG   Aeromonas hydrophila AL09-71: V428_03940Help
Entry
V428_03940        CDS       T03192                                 

Definition
(GenBank) amidase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
ahr  Aeromonas hydrophila AL09-71
Pathway
ahr00330  Arginine and proline metabolism
ahr00360  Phenylalanine metabolism
ahr00380  Tryptophan metabolism
ahr00627  Aminobenzoate degradation
ahr00643  Styrene degradation
ahr01100  Metabolic pathways
ahr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ahr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    V428_03940
   00360 Phenylalanine metabolism
    V428_03940
   00380 Tryptophan metabolism
    V428_03940
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    V428_03940
   00643 Styrene degradation
    V428_03940
Enzymes [BR:ahr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     V428_03940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AHX31265
Position
824613..826316
Genome map
AA seq 567 aa AA seqDB search
MIEVTEVSIAELRAALESGRTTAVELVKAYLARIEAYNGPETATKLNAVVVANPDALKEA
EASDARRARGETLSPLDGIPYTAKDSYLVKGLTAASGSPAFKDLVAQRDAFTVERLRAAG
AICLGKTNMPPMANGGMQRGVYGRAESPYNADYLTAPFASGSSNGAGTATAASFSAFGLA
EETWSSGRGPASNNGLCAYTPSRGVISVRGNWPLTPTMDVVVPYARTMADLLEVLDVVVA
DDADTRGDLWRLQPWVKIPKASEVRPASYLELAAKPDALKGKRLGVPRMFINKDELAGTS
ENPGIGGPTGQRIHTREAVIALWEQARQALEAAGAEVIEVDFPLVSNCEGDRPGAPTVFN
RGIVSPEFLNDELWELSGWAFDDFLRANGDPKLKQLADVDGPKIFPHDPGTLPNREGDLA
AGMDEYVNMAKRGIKRFDEIPTVPDGLRGLEKTRKLDLEDWMDGLKLDAVLFPTVADVGP
ADADVNPASADIAWSNGIWVANGNLAIRHLGVPTVTVPMGVMADIGMPVGLTFAGRAYDD
NNLLRFASAFESTGSKRMVPPRTPPLG
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaagtgaccgaggtttccattgccgagctgcgtgccgcgctcgaatcaggccgc
accacagcggtcgaactggtcaaggcctatctggcccggatcgaggcctacaacggccca
gagactgccaccaaactcaacgccgtggtggtcgccaatcccgatgcgctgaaagaggcc
gaggcttccgatgcccgccgcgcccgtggcgagaccctgagcccgctcgacggcatcccc
tacaccgccaaagacagctatctggtcaaggggctgaccgccgcctccggcagcccggcc
ttcaaggatctggtggcccagcgcgatgcctttaccgttgagcgcctgcgcgctgccggt
gccatctgccttggcaaaaccaatatgccaccgatggccaatggcggcatgcagcgcggc
gtctatggccgtgccgagagcccctacaacgccgactacctgaccgcgccgtttgcctcc
ggctcctccaacggggccggtaccgccaccgccgccagcttctccgcctttggtctggcg
gaagagacctggtcgagcggccgtggcccggcttccaacaacggcctgtgtgcctacacc
ccatcccgtggcgtgatttcggtgcgcggcaactggccgctgaccccgaccatggatgtg
gtggtgccctacgcccgcaccatggccgatctgctggaagtgctcgacgtagtggtggcc
gacgatgccgacacccgtggcgatctgtggcgcttgcagccctgggtcaagatccccaag
gcgtccgaggtgcgtccggcttcctatctggagctggccgccaagcccgatgccctcaag
ggcaagcgcctcggcgtgccgcgcatgtttatcaacaaggatgaactggccggcaccagc
gaaaaccccggcatcggcggcccgaccggtcagcgcatccatacccgcgaggccgtgatt
gcgctgtgggagcaggcccgtcaggcgctggaagccgctggcgccgaagtcatcgaagtg
gacttcccgctggtctccaactgcgaaggggacagacccggcgcgccgaccgtattcaat
cgcggcatcgtgagcccggagtttctcaacgacgagctgtgggagctctccggctgggcg
ttcgacgacttcctgcgcgccaacggcgatcccaagcttaagcaattggccgatgtcgat
gggccgaagatcttcccccacgatccgggcaccctgccgaaccgcgagggcgatctggcg
gcgggcatggacgagtacgtcaatatggccaagcgcggcatcaagcgctttgacgagatc
cccacagtgccggacggtctgcgcggtctggagaagacccgcaagctggatctggaagac
tggatggacgggcttaagctcgacgccgtgctgttcccgacagtggccgatgttggcccg
gctgacgcggatgtgaatccggcctccgccgatatcgcctggagcaacggcatctgggtt
gccaacggtaacctcgccattcgccaccttggcgtgccgaccgttaccgtccctatgggg
gtgatggccgatatcggtatgccggtggggctgaccttcgccggtcgcgcctatgacgat
aacaacctgctgcgctttgcctcggccttcgagtccaccggcagcaagcgtatggtgccg
ccacggacgccgccgttggggtga

DBGET integrated database retrieval system