KEGG   Aeromonas hydrophila AL09-71: V428_06225Help
Entry
V428_06225        CDS       T03192                                 

Definition
(GenBank) acetolactate synthase
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
ahr  Aeromonas hydrophila AL09-71
Pathway
ahr00290  Valine, leucine and isoleucine biosynthesis
ahr00650  Butanoate metabolism
ahr00660  C5-Branched dibasic acid metabolism
ahr00770  Pantothenate and CoA biosynthesis
ahr01100  Metabolic pathways
ahr01110  Biosynthesis of secondary metabolites
ahr01130  Biosynthesis of antibiotics
ahr01210  2-Oxocarboxylic acid metabolism
ahr01230  Biosynthesis of amino acids
Module
ahr_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
ahr_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:ahr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    V428_06225
   00660 C5-Branched dibasic acid metabolism
    V428_06225
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    V428_06225
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    V428_06225
Enzymes [BR:ahr01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     V428_06225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M
Motif
Other DBs
NCBI-ProteinID: AHX31683
Position
1320257..1321927
Genome map
AA seq 556 aa AA seqDB search
MENQHWACGAELVVRHLEAQGVKQVFGIPGAKIDRVFDALEDSPIETIVVRHEANAAFMA
AAVGRLTGKAGVALVTSGPGCANLITGLATATSEGDAMVALGGAVRRADGLKLTHQSLDT
VSLCRPVTKFSAQVGTGSALSEVMANAFRSAELGRPGAAFVSLPMDIINEPADGAILVPS
AIPEPGAADERGIDRALSLLAQARKPVVLLGLLASRPENSLAVRAFLDKSRLPVTGTYQA
AGVVDTHHFDDFAGRVGLFNNQPGDKLLQDADLVVCIGYSPIEYDPVLWNGTGERQLLHI
DALPAEIDSSYCPAVELVGSISANLARLTRMLHQPLARDPAITALLGEIRAQRHQLAEHA
GRLGGTPIHPLRIVKELQDIIGQDMTLCVDMGSFHIWIARYLYSFRARQVLISNGQQTMG
VALPWAIGAAMVRPGEKIISVSGDGSFMQSSMELETAVRLKSNIVHIIWVDNGYNMVAMQ
EEKKYCRSSGVSFGPINFKAYAESFGAAGFAVTCAEDLRATLRAAMAVSGPAVVAIPVDY
SDNHLLMEQLRPEMLS
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatcaacactgggcctgtggggccgaactggtggtgcgccatctggaggcgcaa
ggggtcaaacaggtattcggcattcccggggccaagatcgacagggtattcgatgcgctg
gaggactcccccatcgagaccatagtggtgcgccacgaggcgaatgccgccttcatggcc
gccgccgtcggccggctgaccggcaaggccggagtggcgctggtgacctcggggccgggt
tgtgccaatctcatcaccggtcttgccaccgccacctcggaaggggatgccatggtggcg
ctgggcggtgccgtgcggcgggccgacggcctcaagctgacccaccagagcctggatacc
gtcagcctgtgccggccggtcaccaagttcagtgcccaggtgggcacaggctccgccctc
tccgaggtgatggccaacgcctttcgcagcgccgagctggggcggcccggggcggccttc
gtcagcctgccgatggacatcatcaacgagccggccgatggcgccattctggtgcctagc
gccatccccgagccgggggcggccgacgagcgcggcatcgatcgggcgctgagcttgctg
gcgcaggctcgcaaaccggtggtgctgctcggcctgctggccagccggccggagaactcc
ctcgcggtgcgcgccttcctcgacaagagccggttgccggtgacggggacctatcaggcg
gccggggtggtggatacccaccatttcgacgactttgccgggcgggtgggactgttcaac
aaccagccgggggacaagctgctgcaggatgcggatctggtggtctgcatcggttacagc
cccatcgaatacgaccccgtgttgtggaacggcaccggtgagcgccagctactgcacatc
gatgcgctgccggcggagatcgacagcagctactgcccggcggtggagctggtgggttcc
atcagcgccaacctggcgcggctgacccggatgctgcaccagccgctggcgcgggatccg
gccattaccgcgctgctcggcgagatccgtgctcagcgccatcagctcgccgaacatgcc
ggccggctggggggcacccctatccatccgctgcgcatcgtcaaggagctgcaggacatc
atcgggcaggacatgaccctgtgcgtggacatggggagcttccacatctggattgcccgt
tacctctacagcttccgggcccgccaggtgcttatctccaacggccagcagaccatgggg
gtggcgttgccctgggccatcggggccgccatggtgcggccgggtgagaagatcatctcg
gtgtctggcgacggcagcttcatgcagtcgagcatggagctggagaccgcggtgcggctc
aagtccaacatagtgcacatcatctgggtcgataacggctacaacatggtggcgatgcag
gaggagaaaaagtactgccgcagctccggggtgagtttcggccccatcaacttcaaagcc
tatgccgagtcgttcggggccgccgggtttgccgtcacctgcgccgaggatctgcgagcg
accctgcgcgccgccatggcggtgagcgggccggcggtggtggccatcccggtggattac
agtgacaaccacctgctgatggagcagctcaggcccgaaatgctcagttga

DBGET integrated database retrieval system