KEGG   Aeromonas hydrophila AL09-71: V428_12500
Entry
V428_12500        CDS       T03192                                 

Definition
(GenBank) xanthine dehydrogenase
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
ahr  Aeromonas hydrophila AL09-71
Pathway
ahr00230  Purine metabolism
ahr01100  Metabolic pathways
ahr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ahr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    V428_12500
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: AHX32876
Position
complement(2699221..2699706)
AA seq 161 aa
MMQPQSCPTVAIQCEINGKPYSYAVSPTMSLLHFLRGQGLISVKEGCSVGECGACTVRVN
GTAIDSCLYLAVWADGKSIRTVEGERQGNELSDVQQAFIDEGAVQCGFCTPGLVMASAAL
LDKTERRPLTDAEIRRGLSGNLCRCTGYQNVVRAVKKCCKG
NT seq 486 nt   +upstreamnt  +downstreamnt
atgatgcaaccgcaaagctgtcccactgttgcgatccagtgcgagatcaacggcaaaccc
tactcctacgcggtgtcgcccaccatgtcgctgctccacttcctgcgcgggcaggggctt
atcagcgtaaaagaggggtgcagtgtcggcgagtgcggcgcctgtaccgtgcgggtgaac
ggcacggccatcgacagctgtctttatctggcggtgtgggccgatggcaaatccattcgc
accgtggagggggagcggcagggcaatgagctatccgacgtgcagcaggcctttatcgac
gagggggcggtgcagtgcggcttttgcacgcctggcctcgtgatggcgagcgcagccctg
ctcgacaagaccgaacgccgtccgctgactgatgcggagatccgccgcgggctgtcgggg
aatctgtgccgctgtaccggttaccagaacgtggtgcgggcggtgaagaagtgctgcaag
gggtga

DBGET integrated database retrieval system