KEGG   Aeromonas hydrophila AL09-71: V428_12715Help
Entry
V428_12715        CDS       T03192                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ahr  Aeromonas hydrophila AL09-71
Pathway
ahr00071  Fatty acid degradation
ahr00072  Synthesis and degradation of ketone bodies
ahr00280  Valine, leucine and isoleucine degradation
ahr00310  Lysine degradation
ahr00362  Benzoate degradation
ahr00380  Tryptophan metabolism
ahr00620  Pyruvate metabolism
ahr00630  Glyoxylate and dicarboxylate metabolism
ahr00640  Propanoate metabolism
ahr00650  Butanoate metabolism
ahr00900  Terpenoid backbone biosynthesis
ahr01100  Metabolic pathways
ahr01110  Biosynthesis of secondary metabolites
ahr01120  Microbial metabolism in diverse environments
ahr01130  Biosynthesis of antibiotics
ahr01200  Carbon metabolism
ahr01212  Fatty acid metabolism
ahr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ahr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    V428_12715
   00630 Glyoxylate and dicarboxylate metabolism
    V428_12715
   00640 Propanoate metabolism
    V428_12715
   00650 Butanoate metabolism
    V428_12715
  09103 Lipid metabolism
   00071 Fatty acid degradation
    V428_12715
   00072 Synthesis and degradation of ketone bodies
    V428_12715
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    V428_12715
   00310 Lysine degradation
    V428_12715
   00380 Tryptophan metabolism
    V428_12715
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    V428_12715
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    V428_12715
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    V428_12715
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ahr04147]
    V428_12715
Enzymes [BR:ahr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     V428_12715
Exosome [BR:ahr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   V428_12715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AHX32914
Position
complement(2752736..2753899)
Genome map
AA seq 387 aa AA seqDB search
MDIVIVAAKRTPMGAFQGALANLTAPELGACAIAAAMAEAGLRGEQVDEAYLGNVLSAGV
GQAPARQAVLKAGLPDSIPCTTVSKVCGSGMKAVMLAADGLRLGDTKVVIAGGMESMSRA
PYLLDKARSGFRMGHQSVLDHMFLDGLQDAYEGQLMGHYAQLSADRAGLTRADMDAFAIA
SLERALAAQRSGAFAAELAPVMAGDTLLLAEDEQPAKARPEKIPQLKPAFSKTGTITAAN
ASSISDGAAALILMRSDTAVQLGLPVLARLVGYQSHAALPAEFTSAPVGAIKGLLAKVGW
RVEEVDLFEVNEAFAMVSLLAMAGCQLPHDKVNVNGGACALGHPLGASGARILVTLIHAL
RERGLTRGVASLCIGGGEATAVAIELG
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggatatcgtgattgttgcggccaaacgtacccccatgggggccttccagggagccctg
gccaacctgacggcacctgaactgggggcctgtgccattgccgcggccatggcagaagcg
gggctcaggggagagcaggtcgatgaagcctatctgggcaacgtgctgagtgccggggtc
ggccaggcacccgcccgccaggcggtgctgaaggcgggtctgccggacagcatcccctgc
accacggtcagcaaggtgtgcggttccggcatgaaggcggtgatgctggcggccgatggc
ttgcggctcggcgataccaaggtggtgatcgccggcgggatggagagcatgagccgcgcc
ccatatcttctggacaaggcgcgcagtggttttcggatggggcaccagagcgtgctcgat
cacatgttcctcgacggactgcaggatgcctacgaaggccagctgatggggcattatgcc
cagctgagcgccgatcgcgccggactgacccgtgccgacatggatgcctttgccatcgca
tcgctggagcgggcgctggcggcccagcgcagcggtgcctttgcggcggagctggcgcct
gtgatggccggagataccctgctgctggccgaggatgagcagcctgccaaggccaggccc
gagaagatcccccagctcaagcctgccttcagcaagacgggcaccatcacggcggccaat
gccagctccatctcggacggggcggcggcgctgatcctgatgcgctccgacactgccgtg
cagctgggactgccggtgctggcgcgactggtgggttatcagagccacgcggccctgccc
gccgagtttaccagcgcaccggtaggggccatcaagggcctgctggccaaggtgggttgg
cgggtggaggaggtggatctgttcgaggtcaacgaggcgtttgccatggtcagcctgctg
gcgatggccggttgccagctgccccatgacaaggtcaacgtgaacggcggcgcctgcgcg
ctgggtcatccgctgggggcgagtggtgccaggatcctggtgaccctgatccatgccctg
cgcgaacgcggtctcacacgcggggtggccagtctgtgtatcgggggcggggaggcgacg
gcggtcgccatcgagctgggttaa

DBGET integrated database retrieval system