KEGG   Aeromonas hydrophila AL09-71: V428_14445Help
Entry
V428_14445        CDS       T03192                                 

Definition
(GenBank) trans-2-enoyl-CoA reductase
  KO
K00209  enoyl-[acyl-carrier protein] reductase / trans-2-enoyl-CoA reductase (NAD+) [EC:1.3.1.9 1.3.1.44]
Organism
ahr  Aeromonas hydrophila AL09-71
Pathway
ahr00061  Fatty acid biosynthesis
ahr00650  Butanoate metabolism
ahr01100  Metabolic pathways
ahr01120  Microbial metabolism in diverse environments
ahr01200  Carbon metabolism
ahr01212  Fatty acid metabolism
Module
ahr_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:ahr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    V428_14445
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    V428_14445
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ahr01004]
    V428_14445
Enzymes [BR:ahr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     V428_14445
    1.3.1.44  trans-2-enoyl-CoA reductase (NAD+)
     V428_14445
Lipid biosynthesis proteins [BR:ahr01004]
 Fatty acid synthase
  Component type
   V428_14445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Enoyl_reductase Eno-Rase_NADH_b Eno-Rase_FAD_bd
Motif
Other DBs
NCBI-ProteinID: AHX33227
Position
complement(3141542..3142735)
Genome map
AA seq 397 aa AA seqDB search
MIIKPKVRGFICTTTHPVGCEANVRRQIAYTKAKGTIENGPKKVLVIGASTGYGLASRIA
AAFGSGAATLGVFFEKAGSETKTATAGWYNSAAFDKAAKEAGLYAKSINGDAFSNECRAK
VIELIKQDLGQIDLVVYSLASPVRKLPDTGEVVRSALKPIGEVYTTTAIDTNKDQIITAT
VEPANEEEIQNTITVMGGQDWELWMAALRDAGVLADGAKSVAYSYIGTDLTWPIYWHGTL
GRAKEDLDRAAAAIRGDLAAKGGTAHVAVLKSVVTQASSAIPVMPLYISMAFKIMKEKGI
HEGCMEQVDRMMRTRLYASDMALDDQARIRMDDWELREDVQQTCRDLWPSITSENLCELT
DYTGYKQEFLRLFGFGLDEVDYDADVNPDVKFDVVEL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgatcatcaaacccaaggttcgcggctttatctgcaccaccactcacccagtcggttgt
gaagccaatgttcgtcgccagatcgcttatacaaaggccaagggcaccatcgagaatggt
cccaagaaggtgctggtgatcggcgcttccaccggttatggcctggcttcccgcattgcc
gccgccttcggctccggcgctgccaccctcggtgtcttcttcgaaaaagccggcagcgag
accaagactgccaccgccggctggtacaactccgctgccttcgacaaggccgccaaagag
gcgggcctctacgccaagagcatcaacggcgatgccttctccaacgaatgccgcgccaag
gtgatcgagctcatcaagcaggatctgggtcagattgatctggtggtctactccctggcc
tcaccggtgcgcaaactgccggataccggcgaagtggtgcgctctgccctcaagcccatc
ggcgaggtctacaccaccaccgccatcgacaccaacaaggatcagatcatcaccgccacc
gtcgagccggcgaacgaggaagagatccagaacaccatcaccgtcatgggcggtcaggac
tgggagctgtggatggctgccctgcgcgatgcaggcgtgctggctgacggcgccaagtcc
gtggcttactcctacatcggcaccgacctgacctggccaatctactggcacggtaccctg
ggccgcgccaaggaagatctggaccgcgccgccgccgccatccgtggcgatctggctgcc
aagggcggcaccgcccacgtggccgtgctcaaatccgtggtgacccaggcctcctccgcc
attccggtgatgccgctctatatctccatggccttcaagatcatgaaggagaagggcatt
cacgagggctgcatggagcaggtggaccgcatgatgcgcacccgcctctacgcgtccgac
atggcgctggacgatcaggctcgcatccgcatggatgactgggagctgcgcgaagacgtg
cagcagacctgccgcgacctgtggccgtccatcaccagcgagaacctctgtgagctgacc
gactacaccggctacaagcaggagttcctgcgtctgttcggtttcgggctggacgaggtc
gattacgatgcggatgtgaatccggacgtgaaattcgatgtggtcgagctctga

DBGET integrated database retrieval system