KEGG   Arcobacter halophilus: AHALO_0589Help
Entry
AHALO_0589        CDS       T05822                                 

Gene name
mqo
Definition
(GenBank) malate:quinone-oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
ahs  Arcobacter halophilus
Pathway
ahs00020  Citrate cycle (TCA cycle)
ahs00620  Pyruvate metabolism
ahs01100  Metabolic pathways
ahs01110  Biosynthesis of secondary metabolites
ahs01120  Microbial metabolism in diverse environments
ahs01130  Biosynthesis of antibiotics
ahs01200  Carbon metabolism
Module
ahs_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ahs_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ahs00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AHALO_0589 (mqo)
   00620 Pyruvate metabolism
    AHALO_0589 (mqo)
Enzymes [BR:ahs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     AHALO_0589 (mqo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO Pyr_redox_2 NAD_binding_9 Amino_oxidase Lycopene_cycl NAD_binding_8 Pyr_redox_3 K_oxygenase FAD_binding_3 Thi4 Imm39 TrkA_N DHquinase_II
Motif
Other DBs
NCBI-ProteinID: AXH08975
UniProt: A0A2N1J469
Position
complement(592036..593385)
Genome map
AA seq 449 aa AA seqDB search
MNEKHYEVVIVGGGISGAALYYELAKYTNVKSICMLEKYEDLATLNTKGTSNSQTIHVGD
IETNYTLEKAKITKRTAKMIEKFCLQYNLQDKVMFKHQKMALGVGEKEVEFIKNRYEEFK
TIFPYLELWDKEDLKQLEPKLVYLDNGQERPEPILAMGAKDQYTTVEYGQMTKELAKAAQ
ACENVVTDIFYNSEVDEIEQVGEKYKITTTAGTVFTADFVVVNAGAHSLYLAHKMGYGKH
MGCLPMAGSFYITGGEFLNGKVYMVQNDKLPFAALHGDPDILADGKTRFGPTALMLPKLE
RYKPGTYLDFFKTLNLDGNIIKIFWDLLKDSDIRNYVLRNFLFEVPGLNKKLFVKDARKI
VPSLKEEDIEYAKGFGGVRPQVLNKEEQKLMLGEASINPGTGIIFNMTPSPGATSCLGNA
ERDIQTIAEYLNLEFDRKQFLSDLTEDEE
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagaaacattatgaagtagttattgtcggtggaggtatttctggtgcagcttta
tactacgagcttgcaaaatatacaaatgtaaaaagcatctgtatgttagaaaaatatgaa
gatctcgctactttaaacactaaaggtacaagtaactcacaaacaattcacgtaggtgat
attgaaacaaactacacattagaaaaagcaaaaatcacaaaaagaacagcaaaaatgatt
gaaaagttttgccttcaatataatctacaagataaagttatgttcaaacatcaaaagatg
gcacttggtgttggggaaaaagaagttgaatttataaaaaatagatatgaagagtttaaa
actatatttccttacttagagttatgggataaagaagatttaaaacaattagaaccaaaa
ctagtatatttagataatggtcaagaaagaccagaacctattttagcaatgggtgcaaaa
gaccaatatacaacagttgaatatggtcaaatgactaaagagcttgcaaaagcagcacaa
gcgtgtgaaaatgttgttactgatatattctataactctgaagtagacgaaatagagcaa
gtaggtgaaaaatataaaatcactacaactgcaggtactgtgtttactgctgattttgtt
gttgtaaatgctggtgcacactcactatatttagcacataaaatgggttatgggaaacat
atgggttgtcttccaatggcaggaagtttttatataacaggtggagagttcttaaatggt
aaagtttatatggtacaaaatgacaaactaccatttgcagcacttcatggtgatccagat
attttagctgatggaaaaacaagatttggtccaactgcacttatgcttccaaaactagaa
agatataagcctggtacttatttagatttctttaaaactttaaatttagatggtaatatt
attaaaatattttgggatttattaaaagatagtgatattagaaactatgtattaagaaac
ttcttatttgaagttccaggattaaataaaaaactatttgttaaagatgcaagaaaaatt
gttccatcattaaaagaagaagatattgaatatgcaaaaggatttggaggagtaagacca
caagttcttaataaagaagagcaaaaactaatgttaggtgaagcttcaattaatccagga
acaggaattatatttaatatgactccaagtccaggtgctacatcttgtttaggaaatgca
gaaagagatattcaaacaatagcagaatatttaaatcttgagtttgatagaaaacagttt
ttatctgatttaacagaagatgaagagtaa

DBGET integrated database retrieval system