KEGG   Arcobacter halophilus: AHALO_1142Help
Entry
AHALO_1142        CDS       T05822                                 

Gene name
hemL
Definition
(GenBank) glutamate-1-semialdehyde aminotransferase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
ahs  Arcobacter halophilus
Pathway
ahs00860  Porphyrin and chlorophyll metabolism
ahs01100  Metabolic pathways
ahs01110  Biosynthesis of secondary metabolites
ahs01120  Microbial metabolism in diverse environments
Module
ahs_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:ahs00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AHALO_1142 (hemL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ahs01007]
    AHALO_1142 (hemL)
Enzymes [BR:ahs01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     AHALO_1142 (hemL)
Amino acid related enzymes [BR:ahs01007]
 Aminotransferase (transaminase)
  Class III
   AHALO_1142 (hemL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AXH09520
UniProt: A0A2N1J625
Position
1150331..1151611
Genome map
AA seq 426 aa AA seqDB search
MFDKSITAYEEAKKVIPGGVDSPVRAFKSVGGTPPFIEKGEGAYLVDVDGNRYLDFVQSW
GPLIFGHCDKDIEDAVIKTVKKGLSFGAPTILETELATEIVEMYDNIDKVRFVNSGTEAV
MSAIRLARGVTGKNKILKFEGCYHGHSDSLLVQAGSGMATFGSPSSPGVPADLTKHTLLC
EYNNIEELKKCFEVSDDIACIIIEPIAGNMGFVPADEEFLAQCRKLCDENNALLIFDEVM
SGFRASLTGAHGVVNTKSDIVTFGKVIGAGMPVGAFAASSEIMAHLSPDGAVYQAGTLSG
NPVAMAAGLVSLRKIKAKKDLYENLNNKVAKLLAGFKKAAEDNNIAFQVDSRGSMFGFFF
CEKPPKNFKEVGTCNFDRFAKFHQEMLKRGFYFACSQYEAAFMCEAISDEDIDNCIKAAQ
EVMATL
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgtttgataaatcaataacagcatatgaagaagcaaaaaaagttattcctggaggagtt
gattctccagttagagcttttaaaagtgtaggtggaacacctccatttattgaaaaaggt
gagggtgcttatcttgtagatgtagatggtaatagatatttagattttgttcaaagctgg
ggacctttgatttttggacattgtgataaagatattgaagatgcagtaataaaaactgta
aaaaaaggtttaagttttggtgctccaacaattttagaaacagagcttgcaactgaaatt
gttgagatgtatgataatattgataaagttagatttgtaaatagtggaacagaagcagta
atgagtgctattagattagcaaggggcgttacaggtaaaaataaaatcttaaaatttgaa
ggttgttaccatggacattcagattcattattagttcaagcaggttcaggtatggctaca
tttggaagtccaagttctcctggtgttccagcagatttaacaaagcatacacttctttgt
gaatataacaatattgaagagctaaaaaaatgttttgaagtaagtgatgatattgcttgt
attattattgagccaattgctggaaatatgggatttgttccagcagatgaagagttttta
gcacagtgtagaaaactttgtgatgaaaataacgcacttttaatttttgatgaagtaatg
agtggttttagagctagtttaacaggagctcatggtgtagttaatactaaatctgatatt
gtgacatttggtaaagtaattggagcaggtatgccagttggtgcttttgcagcaagtagt
gaaattatggctcatttaagtcctgatggagcagtttatcaagctggtactttaagtgga
aatccagttgccatggcagcaggacttgtaagtcttagaaaaataaaagcaaaaaaagat
ttatatgaaaatttaaataataaagttgcaaagttattagcaggatttaaaaaagcagca
gaagataacaatattgcatttcaagttgattcaagaggttctatgtttggattctttttt
tgtgaaaaaccaccaaaaaacttcaaagaagttgggacttgtaactttgatagatttgct
aaatttcatcaagagatgctaaaaagaggtttctattttgcttgttctcaatatgaagct
gcatttatgtgtgaagcaattagtgatgaagatattgacaattgtattaaagctgcacaa
gaagtgatggctacattataa

DBGET integrated database retrieval system