KEGG   Antarctobacter heliothermus: ANTHELSMS3_01788Help
Entry
ANTHELSMS3_01788  CDS       T04983                                 

Definition
(GenBank) putative acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
aht  Antarctobacter heliothermus
Pathway
aht00071  Fatty acid degradation
aht00072  Synthesis and degradation of ketone bodies
aht00280  Valine, leucine and isoleucine degradation
aht00310  Lysine degradation
aht00362  Benzoate degradation
aht00380  Tryptophan metabolism
aht00620  Pyruvate metabolism
aht00630  Glyoxylate and dicarboxylate metabolism
aht00640  Propanoate metabolism
aht00650  Butanoate metabolism
aht00900  Terpenoid backbone biosynthesis
aht01100  Metabolic pathways
aht01110  Biosynthesis of secondary metabolites
aht01120  Microbial metabolism in diverse environments
aht01130  Biosynthesis of antibiotics
aht01200  Carbon metabolism
aht01212  Fatty acid metabolism
aht02020  Two-component system
Brite
KEGG Orthology (KO) [BR:aht00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ANTHELSMS3_01788
   00630 Glyoxylate and dicarboxylate metabolism
    ANTHELSMS3_01788
   00640 Propanoate metabolism
    ANTHELSMS3_01788
   00650 Butanoate metabolism
    ANTHELSMS3_01788
  Lipid metabolism
   00071 Fatty acid degradation
    ANTHELSMS3_01788
   00072 Synthesis and degradation of ketone bodies
    ANTHELSMS3_01788
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ANTHELSMS3_01788
   00310 Lysine degradation
    ANTHELSMS3_01788
   00380 Tryptophan metabolism
    ANTHELSMS3_01788
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ANTHELSMS3_01788
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ANTHELSMS3_01788
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ANTHELSMS3_01788
Enzymes [BR:aht01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ANTHELSMS3_01788
Exosome [BR:aht04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ANTHELSMS3_01788
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ASP20476
UniProt: A0A222E2R7
Position
complement(1863629..1864855)
Genome map
AA seq 408 aa AA seqDB search
MQHVRIFDAVRTPRGKGKASVGALAELSPVELATVPLKALKERSNLDTSAVGDVVLGCVD
PVADQGGDIARTAALEAGYDEAVPGVQINRFCASGLEACAIAAGKVASGEVGLAVAGGVE
MMSRIPMLSSGMPVLADPGIAIPRKSVPQGISADLIATLRGYSRDDVDALAVESQRRAGR
AWEKGRFARSIVPVKDRNGLTMLDRDEAIRPGADMQSLGALNPSFERYAKKMGYDAVAEQ
KYPEIGALKYVHHAGNSSQIVDGAAAVLLGSEKAGKENGLTPRARILGLASVGSEPTIML
TGPKAACDRALKQAGLGYADIDLWELNEAFASVVLYFQEETGVSPDRMNVNGGAIAMGHP
LGATGAMILGTLLDELERADKQFGCATLCAATGQAIAMVIERMEGESA
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgcaacatgttcggattttcgacgctgtgcgcacgccgcgcggcaaaggcaaggcctcg
gtcggcgcgctggcagaactcagcccggtggagctggccacggtcccgcttaaagcgttg
aaggaacggtcgaacctcgacacctcagccgtcggcgacgtggtgctcggctgcgtcgat
ccggtggccgatcagggcggcgacatcgcgcgcacggcagcgctggaggcgggctatgac
gaggcggttcccggcgtccagatcaaccgcttttgcgcctcggggctggaagcctgcgcc
atcgcagcgggcaaggtggccagcggcgaggtcggcttggccgtggccggcggggtcgag
atgatgagccggattcccatgctgtcgtcgggcatgccggttctggccgatcccggcatc
gccatcccgcgcaaatcggtgccgcagggcatttcggccgacctgatcgccacgctgcgc
ggatacagccgcgacgacgtggatgcgctggcggtggagagccagcgccgggccggccgc
gcttgggaaaaggggcgctttgcccggtccatcgtgccggtgaaggaccgcaacggcctg
accatgctcgaccgtgacgaggccatccggcctggggcggacatgcagtccctgggcgcg
ctgaacccctcttttgagcgctacgcgaagaagatgggatatgacgccgttgcggagcag
aagtaccccgagatcggcgcgctgaaatacgtccaccatgccgggaattcctcgcagatc
gtcgatggcgcggcggcggttcttctggggtctgaaaaagccggcaaagagaacggcctg
acgccacgcgcccgcatcctcgggctggcctcggtagggtccgagccgacaatcatgctg
accggacccaaggccgcctgcgaccgggcgctgaagcaggccggtctgggctatgccgac
atcgacctgtgggagctgaacgaagcctttgcctctgtggttctttatttccaggaggaa
accggcgtcagtccggaccggatgaacgtcaacggcggggccatcgccatgggccatcca
ctgggggccacgggggcgatgatcctgggcacgctgctcgacgagttggagcgcgcggac
aagcagttcggctgcgccacgctttgcgcggcgacgggacaggcgatcgccatggtgatc
gaacggatggagggagaaagcgcatga

DBGET integrated database retrieval system