KEGG   Antarctobacter heliothermus: ANTHELSMS3_02043Help
Entry
ANTHELSMS3_02043  CDS       T04983                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
aht  Antarctobacter heliothermus
Pathway
aht00071  Fatty acid degradation
aht00072  Synthesis and degradation of ketone bodies
aht00280  Valine, leucine and isoleucine degradation
aht00310  Lysine degradation
aht00362  Benzoate degradation
aht00380  Tryptophan metabolism
aht00620  Pyruvate metabolism
aht00630  Glyoxylate and dicarboxylate metabolism
aht00640  Propanoate metabolism
aht00650  Butanoate metabolism
aht00900  Terpenoid backbone biosynthesis
aht01100  Metabolic pathways
aht01110  Biosynthesis of secondary metabolites
aht01120  Microbial metabolism in diverse environments
aht01130  Biosynthesis of antibiotics
aht01200  Carbon metabolism
aht01212  Fatty acid metabolism
aht02020  Two-component system
Brite
KEGG Orthology (KO) [BR:aht00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ANTHELSMS3_02043
   00630 Glyoxylate and dicarboxylate metabolism
    ANTHELSMS3_02043
   00640 Propanoate metabolism
    ANTHELSMS3_02043
   00650 Butanoate metabolism
    ANTHELSMS3_02043
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ANTHELSMS3_02043
   00072 Synthesis and degradation of ketone bodies
    ANTHELSMS3_02043
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ANTHELSMS3_02043
   00310 Lysine degradation
    ANTHELSMS3_02043
   00380 Tryptophan metabolism
    ANTHELSMS3_02043
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ANTHELSMS3_02043
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ANTHELSMS3_02043
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ANTHELSMS3_02043
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aht04147]
    ANTHELSMS3_02043
Enzymes [BR:aht01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ANTHELSMS3_02043
Exosome [BR:aht04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ANTHELSMS3_02043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ASP20723
UniProt: A0A222E3F5
Position
2120330..2121502
Genome map
AA seq 390 aa AA seqDB search
MQTVVITGAARTPMGGFQGVFAEQPASMLGGAAIRAALAQSGGPAVDELLMGCVLGAGQG
QAPARQAGFAAGLGEEVPATTLNKMCGSGMKAAMIAWDQLALGTASTIVAGGMESMTQAP
YMLPKMRGGARIGHGQVVDHMFLDGLEDAYDKGRLMGTFAEDCAEAFQFTREAQDQYALA
SLSNALDAERSGAFADEITPVTLHMRHGEEVITTDEQPGKARPEKIPMLKPAFRKDGTVT
PANSSSISDGAAALVLSTLDAAIAAGATPRAKILGHASHAQAPSLFPTAPVPAARKLMER
IGWKIGDVDLWEVNEAFAVVPMAFMKEMGLPRDIVNVNGGACALGHPIGASGARIIVTLL
NALEKRGLKRGIAAICIGGGEGTAVAIERI
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgcagacggttgtgatcacaggggcggcccggacaccgatgggcggatttcagggcgtg
tttgccgaacagcccgccagcatgttgggcggcgcggcgatccgcgcggcgctggctcag
tccggtgggccagcggtggatgaactgttgatgggctgcgttctgggcgcaggtcaagga
caggcccccgcgcgtcaggccgggttcgccgccgggctgggcgaagaggtcccggccacc
accctcaacaaaatgtgcggatcgggcatgaaggctgccatgatcgcatgggaccaactg
gcgctgggcactgcctcgaccatcgtcgcgggcggcatggaatcgatgacgcaagcgccc
tacatgctgcccaagatgcgcggcggcgcccggatcggccacggtcaggtggtggaccac
atgttcctcgacgggctggaagatgcctacgacaagggccgcctgatgggcacctttgcc
gaagactgcgctgaggcgtttcagttcacccgtgaggcacaggatcaatacgctcttgcc
tcgctgtcgaatgctctggatgcggaacgctcgggcgcgtttgccgatgagatcacgccg
gtcaccctgcacatgcgccacggcgaagaggtcatcaccaccgatgaacaaccgggcaag
gcgcgcccggaaaagatcccgatgctgaaaccggccttccgcaaggacggcacggtaaca
cccgcaaattcctcgtcgatctcggacggggccgccgcactggtgctgtcgacgctggac
gcggcgattgcggcgggcgcaaccccgcgcgccaaaatcctcggccacgccagccatgca
caagccccctcattgttccccaccgccccggtgcccgcggcccgaaaattgatggaacgg
atcggctggaaaatcggtgatgtggacctctgggaggtgaatgaggccttcgctgtggtc
cctatggccttcatgaaggaaatgggcttgccgcgcgacatcgtcaacgtaaacggcggc
gcctgcgcactgggccaccctatcggcgcctcgggcgcacgcatcatcgtcacgctgctg
aacgcgctggaaaaacgcgggcttaaacgcggcatcgcagcgatctgcatcggcggcggt
gagggcacagccgtagccatcgaacggatctga

DBGET integrated database retrieval system