KEGG   Antarctobacter heliothermus: ANTHELSMS3_02092Help
Entry
ANTHELSMS3_02092  CDS       T04983                                 

Definition
(GenBank) farnesyl diphosphate synthase
  KO
K00795  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
aht  Antarctobacter heliothermus
Pathway
aht00900  Terpenoid backbone biosynthesis
aht01100  Metabolic pathways
aht01110  Biosynthesis of secondary metabolites
aht01130  Biosynthesis of antibiotics
Module
aht_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:aht00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ANTHELSMS3_02092
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:aht01006]
    ANTHELSMS3_02092
Enzymes [BR:aht01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     ANTHELSMS3_02092
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     ANTHELSMS3_02092
Prenyltransferases [BR:aht01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   ANTHELSMS3_02092
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: ASP20770
UniProt: A0A222E3P4
Position
2169464..2170336
Genome map
AA seq 290 aa AA seqDB search
MSFDDGLASAASAIGTHLETVLADFPDLPVTRAMGYAVAGGKRLRGYLVLEGARLHGVAP
ERAIWPACAIEAIHAYSLVHDDLPCMDDDDLRRGLPTVHRKWDEATAVLAGDALQTLGFE
MVARDACHDDPVVRADLALSLARASGAQGMVLGQALDMAAEQADTPLTLDEITALQAGKT
GALICWAAEAGARMARVDLTPLTGYAQRLGLAFQIADDILDVEGDAAQMGKAVGKDADRG
KATFVSLLGLDGAKRRAETLVTEACDCLSLYGAEAINLQQAARFVIARRT
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgagctttgatgacgggctggcgtcggcggcctctgcgatcggcacacatctggaaacg
gtcctggccgactttcccgatctgcctgtgacgcgagcgatgggctatgcagtggcgggt
ggtaaacgcctgcgtggctatctggtgctggagggcgcgcgcctgcatggcgtggcaccg
gagcgcgcgatctggcctgcctgtgcgattgaggcaatccacgcctatagcctcgtccat
gacgatctgccgtgtatggatgacgatgacctgagacgtggtctgcccacggtgcatcgg
aaatgggatgaggcaaccgcagtattggcgggggatgccttacagaccctcgggtttgaa
atggtcgcacgggatgcctgtcatgacgacccggtggtccgagccgatttggcgctgagc
cttgcaagggcctctggcgcgcagggcatggtgcttggacaggcattggacatggcggcg
gaacaggcggatacgccattgacgttggatgagatcacggccctgcaggcgggcaagacc
ggcgcgctgatctgctgggcggcagaggcgggcgcacggatggcgcgtgtcgatctgaca
ccgcttacgggctatgcgcagcgccttggccttgcctttcaaatcgccgatgacattctg
gatgtcgaaggggacgcagcgcagatgggcaaggcggtgggcaaggacgcggatcgcggc
aaggcgacctttgtcagcctgctgggattggacggggcgaaacgccgcgccgaaaccctt
gtgaccgaggcgtgtgattgcctatctttgtatggtgcagaggcgatcaacttgcagcag
gccgcgcgcttcgttattgcgcggcggacctga

DBGET integrated database retrieval system