KEGG   Antarctobacter heliothermus: ANTHELSMS3_04336Help
Entry
ANTHELSMS3_04336  CDS       T04983                                 

Definition
(GenBank) L-2,4-diaminobutyrate decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
aht  Antarctobacter heliothermus
Pathway
aht00350  Tyrosine metabolism
aht00360  Phenylalanine metabolism
aht00380  Tryptophan metabolism
aht01100  Metabolic pathways
aht01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aht00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    ANTHELSMS3_04336
   00360 Phenylalanine metabolism
    ANTHELSMS3_04336
   00380 Tryptophan metabolism
    ANTHELSMS3_04336
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:aht04147]
    ANTHELSMS3_04336
Enzymes [BR:aht01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     ANTHELSMS3_04336
    4.1.1.105  L-tryptophan decarboxylase
     ANTHELSMS3_04336
Exosome [BR:aht04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ANTHELSMS3_04336
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase DUF4129
Motif
Other DBs
NCBI-ProteinID: ASP22940
UniProt: A0A222EA36
Position
complement(4502288..4503691)
Genome map
AA seq 467 aa AA seqDB search
MNWDEFADWGGKAVAFGAEYHKTLRDRPVRPRVSPGEIAAQLPASPPEGGEGMEAILEDF
ERIVMPGLTHWQHPRFFAYFPANAAPPSMLAEMLVTMLAPQCMLWQTSPAATEMEGVMLD
WLRQAVGLPEGFQGVIQDSASSATLAAVLVMRERALGWAGNVQGLAGQPAVRIYCSDQVH
TSIDRAAWVSGVGQENLVKLPAVAEDPLRPMDVAALRAAIAADRAAGYLPAGIIGVTGAT
GMGACDRLGELADVAQAEDLYLHIDAAWAGAGMICPENRVLWEGVERADSMVFNPHKWMG
AQFDCSAHFIRDPDALRQTLAIRPEFLKTLGAEDVTDYSEWSIPLGRRFRALKLWFLIRT
YGLEGLREMIRNHIAWSRDLAARLAAEPDFEIVTAPVLSLFSFRHAGDDAHNLKLVEAIN
ADGRIYLTQNKVDGQVVIRFQVGAFGATGADVATAFDVITEIARDMA
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgaactgggatgagttcgccgattggggcggaaaggccgtggcgtttggcgcggagtat
cacaagaccctgcgcgaccgtcctgtgcggccccgtgtgtcgccgggtgaaatcgcggcg
caattgcccgcttccccgcccgaagggggcgagggcatggaagcgatcctagaggatttt
gagcggatcgtgatgccggggctgacccattggcagcacccgcgattctttgcgtatttc
cctgccaatgccgcgccgccctcgatgttggccgagatgctggtcacgatgctcgcccca
cagtgcatgttgtggcagacctcgcccgccgcgacagaaatggaaggcgtgatgctggac
tggttgcggcaggcggtcgggctgccagaggggtttcagggcgtgattcaggattcggcg
tcctcggccacgttggcggcggtcttggtgatgcgggagcgggcgctgggctgggcgggc
aatgttcagggactggcggggcaaccggcggtgcggatctactgttcggatcaggtgcac
acctcgatcgaccgggcggcttgggtgtcgggtgttgggcaggagaaccttgtgaaattg
cccgccgtcgcggaggatcctttgcgtcccatggacgtggcggcgctgcgcgcggcgatt
gcggcggatcgggcggcggggtacctgcctgcggggatcatcggcgtgaccggggcgacc
ggcatgggcgcttgtgatcggctgggcgaattggctgacgtggcgcaggccgaggatctg
tacctgcacatcgacgcggcatgggccggggcaggcatgatctgccccgaaaaccgagtg
ttgtgggagggtgtcgagcgggccgacagcatggtcttcaacccgcacaaatggatgggc
gcgcagttcgactgttccgcgcattttatccgcgacccagacgcgctgcgtcagacgttg
gcgatccggcccgagttcctcaagacacttggggcggaagatgtgaccgactacagcgaa
tggtcgatcccgctgggtcgtcggtttcgggcgctaaagctgtggttcctgatccggact
tatgggttggaaggtttgcgcgagatgatccgcaatcacattgcttggtctcgtgatctg
gctgcgcggctggcggcggagccggacttcgaaattgtgactgccccggtgctttcgctg
ttcagtttccggcacgccggtgatgatgcccacaatctgaagctggtcgaggcgattaac
gcggatggacggatttacttgacgcagaacaaggtcgacgggcaggtggtgatccggttt
caggtcggagcttttggcgcaactggcgcggatgtggccacagcttttgacgtcataacg
gaaattgctagggacatggcatga

DBGET integrated database retrieval system