KEGG   Azospirillum humicireducens: A6A40_00800Help
Entry
A6A40_00800       CDS       T04409                                 

Definition
(GenBank) succinate--CoA ligase subunit alpha
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
ahu  Azospirillum humicireducens
Pathway
ahu00020  Citrate cycle (TCA cycle)
ahu00640  Propanoate metabolism
ahu00660  C5-Branched dibasic acid metabolism
ahu01100  Metabolic pathways
ahu01110  Biosynthesis of secondary metabolites
ahu01120  Microbial metabolism in diverse environments
ahu01130  Biosynthesis of antibiotics
ahu01200  Carbon metabolism
Module
ahu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ahu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ahu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A6A40_00800
   00640 Propanoate metabolism
    A6A40_00800
   00660 C5-Branched dibasic acid metabolism
    A6A40_00800
Enzymes [BR:ahu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     A6A40_00800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig Phage_GPO CoA_binding_2
Motif
Other DBs
NCBI-ProteinID: ANC90565
UniProt: A0A160JD22
Position
complement(184967..185842)
Genome map
AA seq 291 aa AA seqDB search
MAVLVDKNTKVICQGFTGAQGTFHSEQAIAYGTKMVGGVTPGKGGAKHLDLPIFDTVSEA
VEKTGANASVIYVPPPFAADAILEAIDAEIPLVVCITEGIPVLDMVRVKRALDGSKTRLI
GPNCPGIITPDECKIGIMPGHIHKRGKIGIVSRSGTLTYEAVAQTTAAGLGQTTCIGIGG
DPVNGTNFVDSLELFVKDPETEGIIMIGEIGGDAEVRGAEFIKASGTKKPVVGFIAGRTA
PPGRRMGHAGAVISGGNDTADFKIDFMKSVGIAVADSPASLGSTMLKVFKG
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggctgttctcgtcgacaagaacacgaaggtgatctgccagggcttcaccggagcccag
ggcaccttccactccgaacaggccatcgcctacggcaccaagatggtcggcggtgtgacc
cccggtaagggcggcgccaagcatctcgacctgccgatcttcgacaccgtgtcggaagcg
gtggagaagaccggtgcgaacgccagcgtgatctacgtgccgccgccgtttgccgcggac
gcgatcctggaagcgatcgacgccgagatcccgctggtggtctgcatcaccgaaggcatc
ccggtgctggacatggtccgcgtcaagcgcgccctggatggctccaagacccgcctgatc
ggcccgaactgccccggcatcatcacgccggacgagtgcaagatcggcatcatgccgggc
cacatccacaagcgcggcaagatcggcatcgtctcgcgctccggcacgctgacctatgag
gccgtcgcgcagaccacggcggccggcctcggccagaccacctgcatcggcatcggcggc
gacccggtcaacggcaccaacttcgtcgacagcctggagctgttcgtgaaggacccggag
accgagggcatcatcatgatcggcgagatcggcggcgacgccgaagtccgcggcgccgag
ttcatcaaggcgtcgggcacgaagaagccggtcgtcggcttcatcgccggccgcacggct
cctccgggacgccgcatgggccatgccggtgcggtgatctccggcggcaacgacaccgcc
gacttcaagatcgacttcatgaagtcggtcggcatcgccgtcgccgacagccccgccagc
ctgggctccaccatgctgaaggtgttcaagggctga

DBGET integrated database retrieval system