KEGG   Azospirillum humicireducens: A6A40_03030Help
Entry
A6A40_03030       CDS       T04409                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
ahu  Azospirillum humicireducens
Pathway
ahu00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:ahu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    A6A40_03030
Enzymes [BR:ahu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     A6A40_03030
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     A6A40_03030
    1.1.1.-  
     A6A40_03030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc ADH_zinc_N_2 DAO AlaDh_PNT_C 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ANC93048
UniProt: A0A160JIQ5
Position
complement(672091..673188)
Genome map
AA seq 365 aa AA seqDB search
MKAAVWHGRKDIRVEDVPLPGAPPAGWVQIKVHWCGICGSDLHEYVAGPVFIPVDTPHPL
TGLKGQCILGHEFSGEIATLGEGVSGFAVGDRVAADACQHCGECYYCKHGMYNICEKLAF
TGLMNNGAFASLVNVPAELLYKLPDGFPTEAGALIEPLAVGMHAVKKAGSIVGETVVVVG
AGTIGLCTIMCAKAAGAGRIIVLEMSAARKAKALEVGASIVLDPKECDAVAEVKALTGGY
GADVSFECIGHRDTAKLAIDVIRKAGKTVLVGIFEEPSSFNFFEIVATEKQLIGSLAYNG
EFADVIRFIADGRIDVQPLITGRITLTDIVSGGFEELVAHKDRNVKIIVQPQAVPAAAEQ
PELVH
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccgccgtctggcatggccgcaaggacatccgggtcgaggacgtgccgctgccg
ggcgccccgcccgccggctgggtgcagatcaaggtgcattggtgcggcatctgcgggtcc
gacctgcatgaatatgtcgccggcccggtcttcatcccggtcgacaccccccacccgctg
accggcctgaagggccagtgcatcctcggccacgagttcagcggcgagatcgcgacgctg
ggcgagggcgtcagcggcttcgccgtcggcgaccgggtggcggccgacgcctgccagcat
tgcggcgagtgctattactgcaagcacggcatgtacaacatctgcgagaagctggccttc
accggcctgatgaacaacggcgccttcgccagcctcgtcaacgtcccggccgagctgctc
tacaagctgcccgacggcttcccgaccgaggcgggcgccctgatcgagccgctggcggtc
ggcatgcatgcggtgaagaaggccggcagcatcgtcggcgagacggtggtggtggtcggc
gccggcaccatcggcctctgcaccatcatgtgcgcgaaggcggccggggccgggcggatc
atcgtcctggagatgtcggcggcccgcaaggccaaggcgctggaggtcggcgcgtccatc
gtgctcgatcccaaggagtgcgacgcggtggcggaggtcaaggcgctgaccggcggctat
ggcgccgacgtgtcgttcgaatgcatcggccaccgcgacaccgccaagctcgccatcgac
gtgatccgcaaggccggcaagacggtgctggtcggcatcttcgaggaacccagctccttc
aacttcttcgagatcgtcgccaccgaaaagcagctcatcggatcgctggcctacaatggc
gagttcgccgacgtgatccgcttcatcgccgacggccggatcgatgtgcagccgctgatc
accggccgcatcaccctgaccgacatcgtcagcggcggcttcgaggagctggtcgcccac
aaggaccgcaacgtgaagatcatcgtgcagccgcaggcggtccctgccgccgccgaacag
ccggagctcgtccactga

DBGET integrated database retrieval system