KEGG   Azospirillum humicireducens: A6A40_05765Help
Entry
A6A40_05765       CDS       T04409                                 

Definition
(GenBank) DNA-binding response regulator
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
ahu  Azospirillum humicireducens
Pathway
ahu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ahu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A6A40_05765
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:ahu02022]
    A6A40_05765
Two-component system [BR:ahu02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   A6A40_05765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: ANC91448
UniProt: A0A160JF17
Position
1262071..1262772
Genome map
AA seq 233 aa AA seqDB search
MTEDLPHILVVDDDTRLRELLRKYLASNGFLVSTARDAADARAQLGGLAFDLLVLDIMMP
GESGLSLTESLRRERDLPILLLTARDEPDDRIAGLEAGADDYLAKPFNPRELLLRINSIL
RRQAARPPEPAAPPAVPVRLGPLTYLPDRDELRQGDEVIRLTTAEASLLRILAASPGVTF
TREELTERSKVAGNARTVDVQVTRLRRKIEADPREPRYLHTVRGEGYVLRPDP
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagacctgcctcatatcctggtcgtcgacgacgacacccgcctgcgcgaactt
ctgcgcaagtaccttgcgagcaacggctttctggtcagcacggcccgtgacgccgcggat
gcccgcgcgcagttgggcgggctggccttcgacctgctggtgctcgacatcatgatgccg
ggcgaatccgggctgtcgctgaccgagtcgctgcggcgcgagcgcgacctgccgatcctg
ctgctgaccgcccgcgacgagccggacgaccgcatcgccgggctggaggccggggccgac
gactatctcgccaagcccttcaacccgcgcgagcttctgctgcgcatcaactccatcctg
cgccgtcaggcggcccgtccgcccgaaccggcggcgccgcccgccgtgccggtacggctc
ggccccctgacctatctgcccgaccgggacgagcttcgccagggcgacgaggtgatccgc
ctgacgacggcggaggccagcctgctgcgcatcctcgccgcctcgcccggcgtgaccttc
acgcgcgaggaattgaccgagcgcagcaaggtcgccggcaacgcccgcaccgtcgatgtg
caggtcacacgcctgcgccgcaagatcgaggcggacccgcgcgagccgcgctatctgcac
accgtccgcggcgaggggtatgtgctgaggcccgatccgtga

DBGET integrated database retrieval system