KEGG   Azospirillum humicireducens: A6A40_09390Help
Entry
A6A40_09390       CDS       T04409                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ahu  Azospirillum humicireducens
Pathway
ahu00071  Fatty acid degradation
ahu00280  Valine, leucine and isoleucine degradation
ahu00310  Lysine degradation
ahu00362  Benzoate degradation
ahu00380  Tryptophan metabolism
ahu00620  Pyruvate metabolism
ahu00630  Glyoxylate and dicarboxylate metabolism
ahu00640  Propanoate metabolism
ahu00650  Butanoate metabolism
ahu00900  Terpenoid backbone biosynthesis
ahu01100  Metabolic pathways
ahu01110  Biosynthesis of secondary metabolites
ahu01120  Microbial metabolism in diverse environments
ahu01130  Biosynthesis of antibiotics
ahu01200  Carbon metabolism
ahu01212  Fatty acid metabolism
ahu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ahu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A6A40_09390
   00630 Glyoxylate and dicarboxylate metabolism
    A6A40_09390
   00640 Propanoate metabolism
    A6A40_09390
   00650 Butanoate metabolism
    A6A40_09390
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A6A40_09390
   00072 Synthesis and degradation of ketone bodies
    A6A40_09390
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A6A40_09390
   00310 Lysine degradation
    A6A40_09390
   00380 Tryptophan metabolism
    A6A40_09390
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A6A40_09390
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A6A40_09390
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A6A40_09390
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ahu04147]
    A6A40_09390
Enzymes [BR:ahu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A6A40_09390
Exosome [BR:ahu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A6A40_09390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ANC92100
UniProt: A0A160JGM5
Position
complement(2026456..2027631)
Genome map
AA seq 391 aa AA seqDB search
MTEVVIAGAARTPIGSFNGALSAVPAHVLGEVAIREALARAKTDAAEVNEVIFGQILTAG
QGQNPARQAAVNAGIPVEATAIGVNQLCGSGLRTVALGYQAIKNGDAHILVVGGQESMSM
APHVMHLRNGTKMGSAELLDTMLRDGLTDAFHGYHMGNTAENIAQKWQLTREEQDAFAAA
SQQKAEAAQKSGRFKDEIVPVTIKGRKGDVVVSEDEYPKHGTTVESLAKLRPAFSKDGTV
TAGNASGINDGAAALVLMTAENAAKRGVTPLARIVSWATAGVDPAIMGTGPIPASRKALE
KAGWTVDDLDLIEANEAFAAQALSVNKDLGWDTSKVNVNGGAIALGHPVGASGARVLTTL
LFEMQKRDAKKGLATLCIGGGMGIALCVQRD
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagttgtcatcgccggtgccgcccgtacgcccatcggcagcttcaacggtgcc
ctcagcgccgttcccgcccacgttctgggcgaggtcgcgatccgcgaagcgctggcccgc
gccaagaccgacgcggcggaagtgaacgaggtcatctttggccagatcctgaccgccggc
cagggccagaacccggcccgccaagctgccgtcaacgccggcatcccggtggaggcgacc
gccatcggcgtcaaccagctctgcggttccggtctgcgcaccgtggcgctcggctatcag
gcgatcaagaacggcgacgcccacatcctggtcgtcggcggccaggagagcatgagcatg
gcgccgcacgtcatgcacctgcgcaacggcaccaagatgggttccgccgaactgctcgat
accatgctgcgcgacggcctgaccgacgccttccatggctatcacatgggcaacaccgct
gaaaacatcgcccagaagtggcagctgacccgcgaggagcaggacgccttcgctgcggcc
agccagcagaaggccgaggccgcccagaagtcgggccgcttcaaggacgagatcgtcccg
gtcaccatcaagggccgcaagggcgacgtcgtcgtgtcggaagacgagtatccgaagcac
ggcaccacggtggaatccctggccaagctgcgcccggccttctcgaaggacggcacggtg
accgccggcaacgcctccggcatcaacgacggcgccgccgccctggtgctgatgacggcg
gagaacgcggccaagcgcggcgtcaccccgctggcccgcatcgtctcctgggcgaccgcc
ggcgtcgatccggcgatcatgggcaccggcccgatcccggcctcgcgcaaggcgctggaa
aaggccggctggaccgttgacgacctcgacctgatcgaggcgaacgaggcattcgccgcc
caggcgctgtcggtcaacaaggatctcggctgggacaccagcaaggtcaacgtcaatggc
ggcgccatcgcgctcggccatccggtcggtgcctcgggcgcccgcgtgctgaccacgctg
ctgttcgaaatgcagaagcgtgacgcgaagaagggtctcgccaccctgtgcatcggcggc
ggcatgggcatcgccctctgcgtccagcgcgattga

DBGET integrated database retrieval system