KEGG   Azospirillum humicireducens: A6A40_09715Help
Entry
A6A40_09715       CDS       T04409                                 

Definition
(GenBank) 2-haloalkanoic acid dehalogenase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
ahu  Azospirillum humicireducens
Pathway
ahu00361  Chlorocyclohexane and chlorobenzene degradation
ahu00625  Chloroalkane and chloroalkene degradation
ahu01100  Metabolic pathways
ahu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ahu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    A6A40_09715
   00361 Chlorocyclohexane and chlorobenzene degradation
    A6A40_09715
Enzymes [BR:ahu01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     A6A40_09715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: ANC92152
UniProt: A0A160JGN5
Position
2089838..2090467
Genome map
AA seq 209 aa AA seqDB search
MTATTEPQTPTVVVFDVGQVLIEWDPRHLYRELFDGYEDLMEDFLDRVCTPAWNLEQDRG
RPWSEAVAQLTEEHPDCAELIRAYDDMWERMVPGPIPGTPDILAELKARGVPVYAITNFS
ADKFEMTRKRFDFLNGFDGIIVSGQERLVKPDPAIYRLLIDRYGLEPKHCYFIDDNPDNV
EAAKSVGMSAHLFLGAEALRRDLVALGVL
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcaacgactgagccgcagacgccgaccgtcgtcgtcttcgacgtcgggcaggtg
ctgatcgaatgggatccgcggcatctctaccgcgagctgttcgacggctatgaagacctg
atggaggattttctcgaccgggtctgtacccccgcctggaacctggagcaggaccgcggc
cgtccctggagcgaggcggtcgcccagctgaccgaagagcatccggactgcgccgagttg
atccgcgcctatgacgacatgtgggaacgcatggtgccgggcccgatccccggcacgccg
gacatcctggccgaacttaaggcccgcggagtcccggtctacgccatcaccaacttctcc
gccgacaagttcgagatgacgcgcaagcgcttcgacttcctgaacggcttcgacggcatc
atcgtttcgggtcaggaacgacttgtgaagcccgacccggcgatctaccggctgctgatc
gatcgttacggtctcgaaccgaagcactgctacttcatcgacgacaaccccgacaatgtc
gaggcggccaagtcggtgggcatgtcggcgcacctgttcctgggcgccgaggcgctgcgg
cgcgatctggtggcgttgggggtgttgtga

DBGET integrated database retrieval system