KEGG   Azospirillum humicireducens: A6A40_10880Help
Entry
A6A40_10880       CDS       T04409                                 

Definition
(GenBank) coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
ahu  Azospirillum humicireducens
Pathway
ahu00860  Porphyrin and chlorophyll metabolism
ahu01100  Metabolic pathways
ahu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ahu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    A6A40_10880
Enzymes [BR:ahu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     A6A40_10880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C CHASE2 2CSK_N Apo-CIII
Motif
Other DBs
NCBI-ProteinID: ANC93178
UniProt: A0A160JJ07
Position
complement(2336446..2337786)
Genome map
AA seq 446 aa AA seqDB search
MLAKYDGLRVPRYTSYPTAPHFTPEVNGEVYGGWLEAIDPARSGSLYLHVPFCQKMCWYC
GCHTKIVARYAPIAEYLGHMRREIAMVADRIPGRLAVRHIHFGGGTPTMMAPDDFEAMIA
LLRTRFDVAADAELAVEIDPRALTAEMAAALGRAGVNRASLGVQDFDGTVQEAINRVQPR
AVTEQALAWLKEAGIASVNLDLMYGLPHQSVESVTRSAEIALEMAPDRLSVFGYAHVPWM
KTHQKKIDESVLADSLGRWEQFAAIGDTLAAAGYSAIGLDHFARPGDELAVQQEEGRLGR
NFQGYTTDDAEVLLGFGSSSIGALPQGYVQNAVPFDHYAAAVEEGRLPTGKGIALTRDDT
VRRDLIMRLMCDLSVDTAAIARAHGLAESAFDAELEGMADLVADGVAVVEGRRVHVPESA
RPLMRIVAARFDTHLSKGAGRHSRAV
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
ctgctcgccaagtatgacgggctgcgggtgccgcgttacaccagctatccgaccgcgccg
cacttcacgcccgaggtgaacggcgaggtctatggcggctggctggaagccatcgatccc
gcgcgctccggatcgctctacctgcatgtgcccttctgccagaagatgtgctggtactgc
ggctgccacaccaagatcgtcgcgcgctacgccccgatcgccgagtatctcggccatatg
cggcgcgagatcgccatggtggccgaccgcattcccggccggctggcggttcgccacatc
catttcggcggcggcaccccgaccatgatggcgcccgacgatttcgaggcgatgatcgcg
ctgctgcgcacccgcttcgacgtcgccgccgatgccgaactggcggtggagatcgacccc
cgcgccctgacggcggagatggcggcggcgctgggccgcgccggggtcaaccgcgcctcg
ctgggcgtgcaggatttcgacgggacggtgcaggaggcgatcaaccgcgtccagccgcgc
gccgtgaccgaacaggcgctggcctggctgaaggaggccggcatcgccagcgtcaacctc
gacctgatgtatggtctgccgcaccagtcggtggaaagcgtcacccgctccgccgagatc
gcgctggagatggcgcccgaccggctgtcggtcttcggctacgcccatgtgccgtggatg
aagacccaccagaagaagatcgacgaatccgtgctggccgactcgctcggccgctgggag
cagttcgccgccatcggcgacacgctggccgccgccggctacagcgccatcggtctcgac
catttcgcccgccccggcgacgagctggcggtgcagcaggaggaagggcggctgggccgc
aacttccagggctacaccaccgacgacgccgaggttctgctgggcttcggctcctcctcc
atcggcgcgctgccgcagggctatgtgcagaacgccgtgcctttcgaccactatgccgcc
gccgtcgaggagggccgcctgcccaccggcaagggcatcgcgctgacccgggacgacacg
gtgcggcgcgacctgatcatgcggctgatgtgcgacctgtcggtcgacaccgccgccatc
gcccgtgcccacgggttggccgagtccgccttcgacgccgaactggagggcatggccgat
ctggtcgccgacggcgtcgcggtggtggaggggcgccgcgtccatgtgccggagagcgcc
cgtcccctgatgcgcatcgtggctgcccgcttcgacacccacctgtccaagggcgccggc
cggcatagtcgggcggtttga

DBGET integrated database retrieval system