KEGG   Azospirillum humicireducens: A6A40_12635Help
Entry
A6A40_12635       CDS       T04409                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ahu  Azospirillum humicireducens
Pathway
ahu00480  Glutathione metabolism
ahu00590  Arachidonic acid metabolism
ahu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ahu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    A6A40_12635
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    A6A40_12635
Enzymes [BR:ahu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     A6A40_12635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ANC92666
UniProt: A0A160JHX2
Position
complement(2698523..2699128)
Genome map
AA seq 201 aa AA seqDB search
MTVRTRFRTAALAAIPTALAAVFSMTGGASAMAASSEVNAYSFTFQGIDGRPLPLSQFAG
KAILVVNTASQCGFTPQYQGLQALWQRYRDRGLVVVGVPSDDFGGQEPGTATQIKDFCEV
NYRIDFPMTDKTVVSGDGAHPFYRWASDEMGFIAKPRWNFHKYLVGPDGKLASWFSTMTD
PESDKVREAIERLLPEKAPKS
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtccggacccgctttcgcaccgccgccctggccgccatccctaccgccttggcg
gcggtcttctccatgacgggaggcgccagcgccatggccgccagcagtgaagtcaacgcc
tacagcttcaccttccagggcatcgacgggcgcccgctgccgctgtcgcagttcgcgggc
aaggctatcctggtggtcaacaccgcctcgcaatgcggcttcaccccgcagtaccagggg
ctgcaggcgctatggcagcgctaccgcgaccgtgggctggtggtggtcggcgtgccgtcg
gacgacttcggcgggcaggagcctggaactgcgacccagatcaaggatttctgcgaggtc
aactatcggatcgacttcccgatgacggacaagacggtggtgtcgggcgacggcgcccac
cccttctaccgctgggcgtcggacgagatgggcttcatcgccaagccgcggtggaacttc
cacaagtatctggtcgggccggacggcaagctggcgtcctggttctccaccatgaccgac
cccgagtcggacaaggtgcgcgaagcgatcgagaggctgctgccggagaaggcgccgaaa
tcctag

DBGET integrated database retrieval system