KEGG   Actinomyces howellii: NCTC11636_00061Help
Entry
NCTC11636_00061   CDS       T06068                                 

Gene name
fhs
Definition
(GenBank) Formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
ahw  Actinomyces howellii
Pathway
ahw00670  One carbon pool by folate
ahw01100  Metabolic pathways
ahw01120  Microbial metabolism in diverse environments
ahw01200  Carbon metabolism
Module
ahw_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:ahw00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    NCTC11636_00061 (fhs)
Enzymes [BR:ahw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     NCTC11636_00061 (fhs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA
Motif
Other DBs
NCBI-ProteinID: VEG25489
UniProt: A0A3S4UVD7
Position
1:62608..64383
Genome map
AA seq 591 aa AA seqDB search
MTQDQHESHAQHETGGAPTGSVRGDEDVDLTVLAARAGIAAQHVVPYGRQVAKIDLAALA
PGAAAGEDPARYVVVTAMTPTAFGEGKTTVAIGLAQGLAARGERCALTLRQSAMGPTFGI
KGGAGGSGLARVVPAERMNLHLTGDVHAVTAAHNLLSAVLDNHLHHGNALGIDERTITWP
RVLDVNDRALRHVVVGLGSRSDGVTRQASFDITPASEVMVIMSLATSLADLRARLGRIVV
ARDVEGRWVSAEDLGAAGAMTAVLRDALEPNLLRTAEGTPVLVHTGPFGNIATGCSSVIA
DRVAARGLAGTETLPAGYVLTEAGFGADMGLERFFDIKCAVSGMRPRAAVLVVTVRALKA
HSGRYRVVGGKDLPAQMLEENLEDVRAGAANMLKHLAIVRGFGMEPVVAVNVFPTDHPSE
VAEVARIARGAGARVAPVRPVTEGGRGCVELADAVIEACEQEEPGGAGAGRLYAAEDDLR
TKIAKVAAMYGAQGVDYSPSAARFLEDCERDGFGHLAVVVAKTPLSLSHDPALTGAPTGW
RLPVREVRLAAGAGYVYAVCGSVSTMPGLPSHPAAERIDVDPSTGEIIGLR
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
gtgacccaggaccagcacgagagccacgcccagcacgagaccgggggagcgccgacaggc
tcggtgagaggtgacgaggacgtcgacctcaccgtgctggcggcccgcgcgggcatcgcc
gcccagcacgtcgtgccctacgggagacaggtcgccaagatcgacctggcagccctggcc
ccgggggccgcggccggtgaggacccggcgcgctacgtcgtcgtgaccgcgatgacgccc
accgccttcggggagggcaagacgaccgtggccatcggactggcccagggactggcggcg
cgcggcgagcgctgcgcgctcacgctgcgccagtcggcgatgggcccgaccttcgggatc
aagggaggagccgggggatcggggctggcgcgcgtcgtccccgccgagcgcatgaacctc
cacctcaccggcgacgtccacgccgtcaccgccgcccacaacctgctcagcgccgtcctc
gacaaccacctccaccacggcaacgccctgggcatcgacgagcgcaccatcacctggccc
cgggtcctcgacgtcaacgaccgcgccctgcggcacgtcgtcgtcgggctggggtcccgc
agcgacggggtgaccaggcaggcgtccttcgacatcaccccggccagcgaggtcatggtc
atcatgtccctggcgacctccctggccgacctgcgtgcccgcctgggccggatcgtcgtc
gcccgggacgtcgagggcaggtgggtgagcgccgaggacctcggggcggccggcgcgatg
accgccgtcctgcgcgacgcgctcgagcccaacctcctgcgcaccgccgagggcacgccc
gtcctcgtgcacaccggccccttcggcaacatcgccaccgggtgctcgtcggtcatcgcc
gaccgtgtcgccgcccgaggcctggccggcaccgagacgctcccggcggggtacgtgctc
acagaggccggattcggcgccgacatgggcctggagcgcttcttcgacatcaagtgcgcg
gtctcggggatgcgcccccgtgccgccgtcctcgtcgtgaccgtgcgggcgctcaaggcc
cacagcgggcgctaccgcgtcgtgggaggcaaggacctgcccgcccagatgctcgaggag
aacctcgaggacgtgcgcgccggtgcggccaacatgctcaagcacctggctatcgtccga
ggattcgggatggagccggtcgtggccgtcaacgtcttccccaccgaccacccctcggag
gtcgccgaggtggcccgcatcgcccgcggggcgggcgcgcgcgtcgcgcccgtgcggccc
gtgaccgaggggggccggggatgcgtcgagctcgccgacgccgtcatcgaggcctgcgag
caggaggagcccggtggggccggtgccgggcgcctgtacgcggctgaggacgacctgcgc
acgaagatcgccaaggtcgctgcgatgtacggggcgcagggtgtcgactactcgccgtcc
gcggcccggttcctcgaggactgtgagcgagacgggttcggccacctcgcggtcgtcgtg
gccaagacgcccctgtccctgtcccacgacccggccctgaccggcgccccgaccgggtgg
cggctgcccgtgcgcgaggtccgtctggccgccggcgcgggctacgtctacgccgtctgc
gggtcggtgtcgaccatgcccgggctgccgagccaccccgcggccgagcggatcgacgtc
gacccctccaccggcgagatcatcgggctgcgctga

DBGET integrated database retrieval system