KEGG   Aeromonas hydrophila ML09-119: AHML_06570Help
Entry
AHML_06570        CDS       T02683                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00027  malate dehydrogenase (oxaloacetate-decarboxylating) [EC:1.1.1.38]
Organism
ahy  Aeromonas hydrophila ML09-119
Pathway
ahy00620  Pyruvate metabolism
ahy01200  Carbon metabolism
ahy02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ahy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AHML_06570
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AHML_06570
Enzymes [BR:ahy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.38  malate dehydrogenase (oxaloacetate-decarboxylating)
     AHML_06570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malic_M malic ThiF Pyr_redox_2 DAO ApbA NAD_binding_8 NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: AGM43098
Position
1447759..1449309
Genome map
AA seq 516 aa AA seqDB search
MNDIMMGTSLPYAERKRQGLMGRMPHKEESLAQQRRRIYRLVSAMQSPFDQHLLLRQLQE
DNPVLFYELVRHHLPELLPIIYTPVVGEACQRHSDLYLRSHGLYLSWHDRDELDDIFAAV
EQEVDVIVISDGERVLGLGDLGIGGMGICIGKLALYSAAGGINPARTLPLCVDVGTNNPE
LLEDDSYLGWQAPRVDGESYYHFMDKVVAAIRKRWPQVVLQFEDFAGKHAANLLARYRDE
LCMFNDDIQGTAAVASACVLAGLQQAGSALAETPVLIVGAGSAGCGIAAMLAQLADSTER
VQLFDQDGLVCLDRAGLTPAQQPFARPAAEACHSLVALIERLRPGVLIGVSGQGGLFDAA
VLTAMGEVCERPVILPLSNPTRSAEATPAQVWQATGGRALLATGSPFPPVAVDGTPRVVS
QCNNVYVFPGIGLGACAVKARRISDGMLRAAVQAVGAYPLAEGRLLPPIEQVGEVARTVA
RAVALCARAEGLADFAGDPAPLIDQTWWRPHYWSAS
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacatcatgatgggcaccagcctgccctatgcagagcgcaagcgacagggactg
atggggcgcatgcctcacaaggaggagtcgctggcccaacagcggcgccgcatctaccgg
ctggtttcggccatgcagagcccgtttgatcagcacctgctgctgcgccagctgcaggag
gacaacccggtgctgttctacgagctggtgcgccaccacctgcccgagctgttgcccatc
atctacaccccggtggtgggggaggcgtgccagcgccacagcgatctttatctgcgcagc
cacggcctctacctctcctggcacgaccgggacgagctggatgacatcttcgcggcggtg
gagcaggaggtggacgtcatcgttatctccgatggcgagcgggtgctggggctcggcgat
ctcggcatcggcggcatggggatctgcatcggcaagctggcgctctactccgccgccggc
ggcatcaacccggcgcgcaccctgccgctgtgcgtggatgtgggcaccaacaaccccgag
ctgctggaagatgactcctacctcggctggcaggcaccgcgggtggacggcgagtcctat
taccacttcatggacaaggtggtggccgccattcgcaaacgctggccccaggtggtgctg
cagtttgaagactttgccggcaagcatgccgccaatctgctggctcgctaccgcgatgag
ctctgcatgttcaacgacgacatccagggcacggcggcggtggcatcggcctgcgtgctg
gcgggcctgcaacaggcgggcagtgcgcttgccgagaccccggtgctgatcgtcggcgct
ggctcggccggctgcggcatcgccgccatgctggcccagctggcggacagcacggagcgg
gtgcagctgtttgatcaggatggcctggtctgcctggaccgcgccgggctcaccccggcc
cagcagccgttcgcccgtccggcggcggaggcgtgccactccttggtcgcgctcatcgag
cggctgcgccccggggtgctgatcggagtgagcggtcagggcggcctgttcgacgcggcg
gtgctgacggccatgggggaggtgtgtgagcggccggtgatcctgccactctccaacccc
acccgcagcgccgaggcgaccccggcccaggtgtggcaggcgaccggtgggcgcgccctg
ctcgccaccggcagccccttcccgccagtggcggtggacggaacgccgcgggtggtctcc
cagtgcaacaacgtctatgtgtttccgggcatcggcctcggagcctgcgcggtcaaggcg
cggcgcatcagcgatggcatgctgcgggcggcggtgcaggcggtgggtgcctatccgctg
gccgaagggcggctgctgccccccatcgaacaggttggagaggtggcccgcacggtggcg
agggcggtggcactgtgtgcccgtgccgaggggctggccgattttgccggcgatcccgca
cctttgattgaccagacctggtggcgcccgcactattggtccgcgtcctga

DBGET integrated database retrieval system