KEGG   Aeromonas hydrophila ML09-119: AHML_07175Help
Entry
AHML_07175        CDS       T02683                                 

Definition
(GenBank) Sialidase
  KO
K23550  sialidase [EC:3.2.1.18]
Organism
ahy  Aeromonas hydrophila ML09-119
Pathway
ahy00511  Other glycan degradation
ahy00600  Sphingolipid metabolism
ahy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ahy00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    AHML_07175
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    AHML_07175
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:ahy02042]
    AHML_07175
Enzymes [BR:ahy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     AHML_07175
Bacterial toxins [BR:ahy02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   AHML_07175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sial-lect-inser BNR_2 BNR_3 BNR Sortilin-Vps10
Motif
Other DBs
NCBI-ProteinID: AGM43219
Position
1580377..1581945
Genome map
AA seq 522 aa AA seqDB search
MVAFAEGRASSHDPGSGYPTSIKSRRSTDNGITWSDYYVIHEGVNEAYSDPRPFIDKING
RMFVFYTKWDNRCAQNGNCVPFDDPQHKLLYRSSDDNGKTWSSPVDILAKVRDTNWMANG
ISGLATWSLTPSQTQIEQARNMGWSLNWVSRVADGRCNVQYYGDGNKRFLADLQVNADKS
VKAVLYTDTGTLEHPLALDVSGYHSYQIKGSGGTASFYVDGQLVASKWLGQTHASKTVTW
GNGCSNTAGAIAYQSVDFRIGNSSQLAFNANLMKRVNGTVVNTPTDQGWSQILTSSGKGG
PGWKSINAGPGQGIQLSNGRLIFPAIVLDAFAQLSVVSIYSDDHGETWKAGTQTPTYAHE
PSEADMVELNDGRLLLSARNDGVTGVGNFNRYQFISSDQGISWKMILEDRNSINGSLFFK
LNPVDIGLLNYDGNRLLMSGPQGNTAVSSDRNDLAIWSATDDGTGSYNFTKRTQVRDGYS
AYSDLVKLQSQGANGNEDIGVIYEASPSTEIRFMVLDINEVE
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
ttggttgcattcgcggaagggcgagcctcaagtcacgatcctggcagtggctatcctact
agcataaaaagccggcgttcaacggacaatggtatcacatggagtgattattatgttatc
catgagggagttaatgaagcatattctgatccacgaccatttatagataaaatcaacgga
aggatgtttgttttttatactaagtgggataaccgatgtgctcagaatggtaattgtgta
ccattcgatgacccacaacataagttattatatcgtagcagcgatgataatgggaaaaca
tggtcatctcccgttgatattttagcgaaagtcagagacaccaactggatggctaatggt
atatcagggctggctacttggtctctgacaccatcacaaactcagattgaacaagcaaga
aatatgggttggagtttgaattgggtatcccgtgttgctgatggaagatgtaatgtacag
tattacggggatggtaataaacgattcttggctgatttacaagtcaatgcagataaatca
gtaaaggcagttctctatactgacactggaactctggagcaccctcttgctttggatgtt
tcgggataccatagctatcaaataaaaggttcaggggggacagctagtttttatgttgat
ggtcaactggttgcttcaaaatggcttggacaaactcatgctagtaaaacagtaacatgg
ggtaatggctgttcaaacaccgcaggcgcaattgcttatcaaagcgttgattttagaatt
ggtaatagttcacagcttgcttttaatgcaaatttgatgaagcgagttaatggaacggtc
gttaatactccaaccgatcaaggctggtcacaaatacttacatcaagtggtaaaggtgga
ccaggttggaaaagcatcaacgctggcccaggacaaggcatccaattgtccaatggaagg
ttgatattcccagcgattgtgctcgatgcatttgcacagttatctgtagtttcaatttat
agtgatgatcatggcgaaacttggaaagctggtactcaaacgccaacttatgcacatgaa
ccgagtgaagccgatatggttgagttaaatgacggacgacttttattgtcagcacgaaat
gatggggttacgggggttggtaattttaatcgctaccaatttatcagctcagatcagggt
ataagctggaaaatgatattggaagacagaaactcaattaatggttcgctgttcttcaaa
ctgaatccagttgatataggtttgttgaactatgatggtaaccgattactaatgtctggc
ccacaaggaaatacagcagtgagctctgacagaaatgacctcgctatttggagtgccact
gacgatggtacaggaagctataactttactaaaagaacccaggtgagagatgggtatagt
gcctattctgatcttgtaaagcttcaaagccaaggagctaatggtaatgaagatataggt
gttatatatgaggcttctccgagcactgaaattaggttcatggtactcgatattaacgaa
gtagagtaa

DBGET integrated database retrieval system