KEGG   Aeromonas hydrophila ML09-119: AHML_12125
Entry
AHML_12125        CDS       T02683                                 

Definition
(GenBank) xanthine dehydrogenase subunit XdhC
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
ahy  Aeromonas hydrophila ML09-119
Pathway
ahy00230  Purine metabolism
ahy01100  Metabolic pathways
ahy01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ahy00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AHML_12125
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: AGM44205
Position
complement(2699572..2700057)
AA seq 161 aa
MMQPQSCPTVAIQCEINGKPYSYAVSPTMSLLHFLRGQGLISVKEGCSVGECGACTVRVN
GTAIDSCLYLAVWADGKSIRTVEGERQGNELSDVQQAFIDEGAVQCGFCTPGLVMASAAL
LDKTERRPLTDAEIRRGLSGNLCRCTGYQNVVRAVKKCCKG
NT seq 486 nt   +upstreamnt  +downstreamnt
atgatgcaaccgcaaagctgtcccactgttgcgatccagtgcgagatcaacggcaaaccc
tactcctacgcggtgtcgcccaccatgtcgctgctccacttcctgcgcgggcaggggctt
atcagcgtaaaagaggggtgcagtgtcggcgagtgcggcgcctgtaccgtgcgggtgaac
ggcacggccatcgacagctgtctttatctggcggtgtgggccgatggcaaatccattcgc
accgtggagggggagcggcagggcaatgagctatccgacgtgcagcaggcctttatcgac
gagggggcggtgcagtgcggcttttgcacgcctggcctcgtgatggcgagcgcagccctg
ctcgacaagaccgaacgccgtccgctgactgatgcggagatccgccgcgggctgtcgggg
aatctgtgccgctgtaccggttaccagaacgtggtgcgggcggtgaagaagtgctgcaag
gggtga

DBGET integrated database retrieval system