KEGG   Aeromonas hydrophila ML09-119: AHML_16755Help
Entry
AHML_16755        CDS       T02683                                 

Definition
(GenBank) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
ahy  Aeromonas hydrophila ML09-119
Pathway
ahy00230  Purine metabolism
ahy00250  Alanine, aspartate and glutamate metabolism
ahy01100  Metabolic pathways
Module
ahy_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:ahy00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AHML_16755
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AHML_16755
Enzymes [BR:ahy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     AHML_16755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: AGM45119
Position
3802518..3803774
Genome map
AA seq 418 aa AA seqDB search
MSSIVVVGANWGDEGKGRIVDYLAGQAGASIRFQGGNNAGHTVVNDLGTFKLHQVPSGVF
NPDCLVVLGPGMVISPEKLTVELDEVKASGVTPKLAISDRATLCLPLHAMEDTLEEQRLG
DGAYGSTRQGIAPAYGDRVMKKAILVGWLKQPEVLVERIQFFLDWKLPQLKALYPTFEFN
QTAQEMADWLLEVSAPWIDSVCNVSMPLKALQAEGKALLFEAQLGAGRDLIYGEYPWVTS
SHVSGAYAGIGGGLPGLRPERVIAVAKAFSTSVGTGTLLTAMENQDEFRKIANEFGATTG
RPRDVGYFDAVATKNGVELQAANEVALTKLDCLTGLPDLKICVAYEGAHTENPIWPQTAG
LKPVYEVMESWSEDITGCRTFAELPKAAQQYVLRIEELLGVPVPMVSVGPGRDEMILR
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctatcgtagtcgtaggtgccaactggggtgatgaaggcaaaggccgcatcgtg
gattatctggcaggccaagcaggcgccagcattcgcttccagggcggcaacaacgccggc
cataccgtcgtcaacgaccttggcaccttcaagctgcaccaggttccgagcggtgtattc
aacccggattgcctggtcgtgctcggccctggcatggtgatcagccccgagaaactgacc
gtcgagctggacgaagtgaaagcctccggcgtcactcccaagctggccatctctgatcgc
gccaccctctgcctgccgctgcacgccatggaagataccctggaagagcagcgtctgggc
gacggcgcctacggttccacccgtcagggcatcgcccctgcctacggcgatcgcgtcatg
aagaaagcgatcctggtgggctggctgaagcagccggaagtgctggtcgagcgcattcaa
ttcttcctcgactggaaactgccgcagctcaaagcgctctacccgaccttcgaattcaac
cagaccgcccaggagatggccgactggctgctggaagtgtccgctccctggatcgactcc
gtctgcaacgtcagcatgccgctcaaagcgctgcaggccgaaggcaaggccctgctgttc
gaagcccagctgggcgccggccgtgacctgatctacggcgaatacccctgggtgacctcc
tcccacgtttccggcgcctatgccggcatcggtggcggcctgccgggtctgcgtcccgag
cgcgtcatcgccgtcgccaaggcgttcagcacctccgtcggtaccggcaccctgctgacc
gccatggagaaccaggacgagttccgcaagatcgccaacgagttcggcgccaccaccggt
cgtccccgtgacgtcggctacttcgacgccgtcgccaccaagaacggtgtcgagctgcag
gctgccaacgaagtggcgctgaccaagctggactgcctgaccggtctgccggatctgaag
atctgcgtcgcctacgaaggtgcccacaccgagaacccgatctggccgcaaactgccggt
ctgaagccggtttacgaagtgatggagagctggagcgaagacatcaccggctgccgcacc
ttcgccgagctgcccaaagcagctcagcagtacgtactgcgcatcgaagagctgctgggc
gtaccggtgccgatggtctccgtcggcccgggccgtgacgagatgatcctgcgctaa

DBGET integrated database retrieval system