KEGG   Algibacter alginicilyticus: APS56_08840Help
Entry
APS56_08840       CDS       T04100                                 

Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
ahz  Algibacter alginicilyticus
Pathway
ahz00670  One carbon pool by folate
ahz00790  Folate biosynthesis
ahz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ahz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    APS56_08840
   00670 One carbon pool by folate
    APS56_08840
Enzymes [BR:ahz01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     APS56_08840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1 2TM 7tm_7 EMC3_TMCO1
Motif
Other DBs
NCBI-ProteinID: ALJ05222
UniProt: A0A0N7HYG9
Position
2107223..2108143
Genome map
AA seq 306 aa AA seqDB search
MFGKKKLPPQIDKDQLELIQNAQKRIKQKKRLYAHFVIFLLGAVFLILANTVLGIGQDIT
FFGKEWFLFAILIWSFFFIYHLFNVFITHKFMGKDWEQKQLDKLVAKQKERIDILKKNLS
KEEIGQAKNEVLKEQKSKALKLNKSNLTIIVAAAKNDAIGKDNKLIWHLSDDLKRFKNLT
NGHHIIMGRKTFESFPQPLPNRTHVVITRQQNYQVPNGVIVVNNLEDAIDASKNDSQPFI
IGGGEIYKQAMTVANKIELTRVHNDFEADTFFPEIDPSAWEEVSNTYHEKDENHKYDFSF
ITYLKK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgttcggaaaaaagaaactacccccccaaatagataaagaccaattagagttaattcaa
aatgctcaaaaacgtattaaacaaaaaaagcgtttatatgcccattttgtaattttttta
cttggtgctgtttttttaattcttgccaatacggttttgggtattggtcaagacatcact
ttttttggaaaagaatggtttttattcgctatactaatttggtcattcttttttatatat
catctatttaatgtatttattactcataaatttatgggtaaagactgggaacagaaacag
cttgataaattagtcgctaaacaaaaagaacgcattgatatcttgaaaaaaaacctttct
aaagaagaaatcggccaagcaaaaaatgaggttttaaaagaacagaaatcaaaagctctt
aaacttaataaatcaaaccttactataatagttgcggccgcaaaaaacgatgctattggt
aaagacaataaactaatctggcacttgagtgacgatttaaaacgttttaaaaacctcacc
aatgggcatcatattattatggggcgaaaaacttttgaaagttttccacaaccgcttcct
aacagaactcatgttgttattactcgtcaacaaaattatcaggtgccgaacggtgtgatt
gtggttaataatttggaagatgctattgatgcttcaaaaaacgattcacaaccctttatt
attggtgggggcgaaatttacaaacaagctatgactgttgctaacaaaattgaattaact
agagtccataatgattttgaagccgataccttttttccagaaatagacccttctgcatgg
gaagaagttagcaacacataccatgaaaaagatgaaaaccataagtacgatttctctttt
attacatatctaaaaaagtaa

DBGET integrated database retrieval system