KEGG   Acinetobacter indicus: CTZ23_01435Help
Entry
CTZ23_01435       CDS       T05342                                 

Definition
(GenBank) methyltransferase domain-containing protein
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
aid  Acinetobacter indicus
Brite
KEGG Orthology (KO) [BR:aid00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:aid03009]
    CTZ23_01435
Enzymes [BR:aid01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     CTZ23_01435
Ribosome biogenesis [BR:aid03009]
 Prokaryotic Type
  rRNA modification factors
   23S rRNA modification factors
    CTZ23_01435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_31 Methyltransf_23 Methyltransf_32 Ubie_methyltran Methyltransf_12 Methyltransf_9 MTS PrmA PCMT AdoMet_MTase Trm112p CMAS
Motif
Other DBs
NCBI-ProteinID: AVH13092
UniProt: A0A2L2IZU8
Position
294057..294860
Genome map
AA seq 267 aa AA seqDB search
MNLLMCPVCRQPLSLTDRTWRCDNKHSYDVAKQGYVNLHVVQHKHSKNPGDTPESVQARR
AFLSAGHYAPLQQAVVEKIRSLRIENLLDIGCGEGYYTNAMQVEVLQCVGVDIAKNAVQV
AAKLNKDVTWVVGSGAILPVLDKSIDLCTSLFSPIPKEEILRVLKPEAYLMVVTPGPQHL
FAMREALFEEVKAHEPQKFVEQLKDAFELVSEDIVDAAMCLNQSDLKHLIAMTPYAYKAK
PERRQALEQQDQFLLNAQYQIYLFQKK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgctgatgtgtcctgtctgtcgtcagcccttaagcctgaccgaccgaacatgg
cgctgtgacaacaagcacagttatgatgtggccaaacagggctatgtcaatttgcatgtg
gtgcaacataagcacagtaaaaatccgggcgataccccggagtctgtacaggcacgccgg
gcatttttaagtgcaggacactatgcgccgctgcagcaggcggtggtagagaaaattcgc
agcctgcgtattgaaaacctgcttgatattggctgtggggaaggctattacaccaatgcc
atgcaggttgaagtgctgcaatgcgtgggcgtcgatattgccaaaaatgcagtgcaggtg
gcggccaaactgaataaagacgtgacctgggtggttggaagcggtgcgattttaccggtt
ttggataaatcaattgatctgtgtaccagcctgtttagccccattccaaaagaggaaatt
ctgcgggtgctgaaaccggaagcttatctgatggtggtaaccccgggaccgcagcatctg
tttgccatgcgcgaagccttgtttgaagaagtcaaagcgcatgagccacagaagtttgtg
gaacagctaaaagatgcgtttgagttggtcagtgaagatatcgttgatgcagcaatgtgt
ttaaatcagagcgatttaaaacatctgattgcgatgacaccgtatgcctataaggccaag
ccggaacgtcgtcaggcgctggagcagcaggaccagttcctgctgaatgcgcaataccag
atatatctgtttcagaaaaagtaa

DBGET integrated database retrieval system