KEGG   Acinetobacter indicus: CTZ23_01795Help
Entry
CTZ23_01795       CDS       T05342                                 

Gene name
hemN
Definition
(GenBank) oxygen-independent coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
aid  Acinetobacter indicus
Pathway
aid00860  Porphyrin and chlorophyll metabolism
aid01100  Metabolic pathways
aid01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aid00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CTZ23_01795 (hemN)
Enzymes [BR:aid01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     CTZ23_01795 (hemN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C Fer4_14 Fer4_12
Motif
Other DBs
NCBI-ProteinID: AVH13151
UniProt: A0A2L2IZZ1
Position
367845..369218
Genome map
AA seq 457 aa AA seqDB search
MLKPASSLVQKYNVPGPRYTSYPTVPYWEEVSFSREAWQQSLQRAFAESNASEGISLYIH
LPFCESLCTFCGCHKRVTKRHEVEQPYIQAVLKEWDLYCQLLPDRPMIKEIHLGGGTPTF
FSVTHLQQLIQGILAKATVAPEHEFSFEGHPNNTTREHLQALYDLGFRRVSYGVQDYNEK
VQKAIHRIQPYEHVQRVTEWARDIGYTSISHDLVFGLPFQNLEDVLHTIQRTTQLNPDRL
AFYSYAHVPWIKGNGQRGFKDDDVSKDELKRTLYEEGKKKLLAHGYHEIGMDHFALKSDA
MYQAFQQGSLHRNFMGYTASKTQLMIGLGLSSISDSWYSFAQNEKTLEDYYARLEQNEIP
VFRGHVLTAEDLMIRRHILNLMCSFHTSWAEPEMQFPELPEVLKQLEEMQEDGLLTLFED
HLQVTEQGKPFVRNICMAFDLRLKRKVPSTRIFSMTI
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaaccggccagttctctcgtacaaaaatacaatgttccgggaccccgctatacc
agttatccaaccgtaccgtattgggaagaggtcagtttttctcgcgaggcctggcagcag
agcttgcaacgcgcatttgctgaatccaatgccagcgaaggcatcagcctgtatatccat
ctgcccttttgcgaaagtttatgtaccttctgcggttgccataagcgtgtgaccaaacgc
catgaagtggagcaaccctacattcaggcggtgctgaaagagtgggatttatattgccag
ttgctgccagaccggccgatgattaaagaaatccatttgggtggcggcacgccgactttc
ttttctgtaacccatttacagcagctgattcagggcattctggccaaagccacagtggcg
cctgagcatgaattcagttttgaaggccatccgaacaataccacccgagaacatttgcag
gcgctgtatgatctgggctttcgccgggtcagctatggcgtgcaggactataatgaaaag
gtccagaaagccatccaccggattcagccttatgaacatgtgcagcgtgtgaccgaatgg
gcgcgtgatattggctacacgtcaatttcgcatgatctggtttttggtctgccttttcag
aatctggaggatgttttacataccattcagcggactacccagttaaatccggaccgtctg
gctttttatagctatgcgcatgtgccgtggattaaaggcaatggtcagcgcggttttaaa
gatgatgatgtgtcaaaagatgaactgaaacgtaccctgtatgaagagggcaagaagaaa
ttgctggcgcatggttatcatgaaattggcatggatcattttgctctgaaaagcgatgcc
atgtatcaggcctttcagcagggcagtctgcaccgtaactttatgggctataccgcttcc
aaaacccagctgatgattgggcttgggttatcttccatcagtgatagctggtatagcttt
gcgcaaaatgaaaagaccctggaagattattatgcgcgactggagcagaatgaaattccg
gtatttcgtgggcatgtactgactgccgaagacctgatgattcgcaggcatattctgaac
ttgatgtgcagtttccacacttcatgggccgaaccagagatgcagttcccggaattgcct
gaggtgctcaagcagctggaagaaatgcaggaagatggtttgttaacgctgtttgaggat
catttacaggttacggagcagggcaaaccgtttgtacgtaatatctgtatggcgtttgat
ttgcgtttaaaacgtaaagtaccgagtacccgtattttctcgatgacgatttaa

DBGET integrated database retrieval system