KEGG   Acinetobacter indicus: CTZ23_14930Help
Entry
CTZ23_14930       CDS       T05342                                 

Definition
(GenBank) N-acetyltransferase
  KO
K13018  UDP-2-acetamido-3-amino-2,3-dideoxy-glucuronate N-acetyltransferase [EC:2.3.1.201]
Organism
aid  Acinetobacter indicus
Pathway
aid00520  Amino sugar and nucleotide sugar metabolism
aid01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aid00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CTZ23_14930
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:aid01005]
    CTZ23_14930
Enzymes [BR:aid01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.201  UDP-2-acetamido-3-amino-2,3-dideoxy-glucuronate N-acetyltransferase
     CTZ23_14930
Lipopolysaccharide biosynthesis proteins [BR:aid01005]
 Unusual sugar
  CTZ23_14930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexapep Hexapep_2 DUF4954
Motif
Other DBs
NCBI-ProteinID: AVH15443
UniProt: A0A2L2J6I6
Position
complement(3080420..3081007)
Genome map
AA seq 195 aa AA seqDB search
MSFYQHESAIVDEGAQIGEGSRVWHFVHVCGGAKIGQGVSLGQNVFVGNKVVIGDHCKVQ
NNVSVYDNVTLEEGVFCGPSMVFTNVYNPRSLIERKDEYRNTLVKKGATLGANCTIVCGV
TIGEYSFVGAGAVVNKDVPAYALMVGVPAKQIGWMSEFGEQLDLPLEGEAQVACEHTGAI
YRLNGKVVTKEQAAA
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgagtttttatcaacatgaaagtgcaattgtagatgagggtgctcaaattggtgaaggt
tcacgagtttggcattttgtgcatgtttgtggcggtgccaaaatcggtcaaggcgtatct
ttaggacaaaacgtatttgttggcaataaagttgtgattggcgaccattgtaaagttcaa
aataatgtgtcggtctatgacaatgtcacccttgaagaaggggtattttgtgggccgagc
atggtatttaccaatgtatataacccacgctctctcattgagcgtaaagatgaataccgt
aatacccttgtgaaaaagggtgcaacattgggtgctaattgcactattgtttgcggtgtc
acgattggtgagtattcatttgtaggtgcgggtgctgtagtgaataaagatgtacctgct
tatgccttgatggttggtgtacctgcaaaacaaattggctggatgagtgaatttggtgaa
caattggatttaccgttagagggtgaagcacaagttgcatgtgagcataccggggcaatt
taccggctgaatggtaaggttgtaacaaaagagcaggctgcagcatga

DBGET integrated database retrieval system