KEGG   Acidaminococcus intestini: Acin_0719Help
Entry
Acin_0719         CDS       T01639                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
ain  Acidaminococcus intestini
Pathway
ain00071  Fatty acid degradation
ain00072  Synthesis and degradation of ketone bodies
ain00280  Valine, leucine and isoleucine degradation
ain00310  Lysine degradation
ain00362  Benzoate degradation
ain00380  Tryptophan metabolism
ain00620  Pyruvate metabolism
ain00630  Glyoxylate and dicarboxylate metabolism
ain00640  Propanoate metabolism
ain00650  Butanoate metabolism
ain00900  Terpenoid backbone biosynthesis
ain01100  Metabolic pathways
ain01110  Biosynthesis of secondary metabolites
ain01120  Microbial metabolism in diverse environments
ain01130  Biosynthesis of antibiotics
ain01200  Carbon metabolism
ain01212  Fatty acid metabolism
ain02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ain00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Acin_0719 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    Acin_0719 (atoB)
   00640 Propanoate metabolism
    Acin_0719 (atoB)
   00650 Butanoate metabolism
    Acin_0719 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Acin_0719 (atoB)
   00072 Synthesis and degradation of ketone bodies
    Acin_0719 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Acin_0719 (atoB)
   00310 Lysine degradation
    Acin_0719 (atoB)
   00380 Tryptophan metabolism
    Acin_0719 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Acin_0719 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Acin_0719 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Acin_0719 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ain04147]
    Acin_0719 (atoB)
Enzymes [BR:ain01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Acin_0719 (atoB)
Exosome [BR:ain04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Acin_0719 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ZoocinA_TRD Pro-kuma_activ
Motif
Other DBs
NCBI-ProteinID: AEQ21954
UniProt: G4Q4P1
Position
731369..732550
Genome map
AA seq 393 aa AA seqDB search
MREVVIASAVRTAIGKFGGSLLPLSAPELGAIVIKEALKRANVPGEKVDEVIFGNVLQAG
LGQNPARQASIKAGLPIEVPAFTVNKVCGSGLKCVELAAQSILAGDNDIVVAGGMESMSN
APFVTSGKARWGLRMGDSKLVDVMIKDGLWDAFNNYHMGITSENVAEKFGVTREDQDEVS
ARSQQRAIAAIKSGAFKDEIVPVTIKTKKGETVFDTDEFPREGTTTEILAKLRPAFKQGG
TVTAGNASGLNDGAAALVIMSAEKAQELGIKPMAKILSYASAGVDPAIMGIGPIPASRKA
LSKAGLEVKDLDLIEANEAFAAQFVEVGRELNFDPDKVNVNGGAIALGHPIGASGARILV
TLLYALKNRDKKLGLATLCIGGGMGTSAVVEML
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgaagttgtaattgcaagtgctgtaagaacggctatcggcaaatttggtggcagc
ctgcttcccctgtctgcccctgaactcggtgcaattgtcatcaaggaagccctgaaaaga
gctaatgtccctggtgaaaaagttgacgaagtcatttttggtaacgtcctccaagctgga
ctgggccaaaaccctgctcgtcaggcatccatcaaagctggcctgcctattgaagttcct
gcttttactgtcaataaagtctgcggttccggcctgaaatgtgtggaactggctgctcag
tccatcctggctggcgataacgacatcgtcgttgccggcggtatggaaagcatgtccaac
gctccttttgttaccagcggcaaagctcgttggggtctgcgtatgggcgacagcaaactc
gtcgatgtcatgatcaaggatggtctgtgggatgcgttcaataactatcacatgggcatc
acttccgaaaacgtcgctgaaaaattcggcgtaacccgtgaagaccaggacgaagtttct
gcccgttcccagcaaagagccattgcggccatcaagagcggtgctttcaaggacgaaatc
gttcctgttaccatcaaaaccaaaaagggcgaaaccgtatttgatacggatgaattcccg
cgtgaaggaaccacgacggaaatcctggccaaactgcgtcctgcctttaaacaaggcggc
acggtcacggctggcaacgcttccggtctgaacgacggggctgccgcccttgtcatcatg
agcgcggaaaaagcacaggaactcggcatcaaaccgatggcgaagatcctgtcctatgct
tctgccggtgtcgatcctgccatcatgggcattgggcctatccctgcaagccgcaaagcc
ctctccaaggcaggtctggaagtcaaggaccttgacctcatcgaagccaacgaagcgttt
gctgctcagttcgtagaagtcggccgtgagctgaacttcgatcctgataaagtcaacgtc
aatggcggtgccattgccctcggtcacccgattggggcttccggcgcccgcattcttgta
acgcttctgtacgcactgaaaaaccgcgacaagaagcttggcctggcaacgctctgcatc
ggcggcggtatgggtacgtctgctgttgtggaaatgttataa

DBGET integrated database retrieval system