KEGG   Acidaminococcus intestini: Acin_0994Help
Entry
Acin_0994         CDS       T01639                                 

Gene name
hisC
Definition
(GenBank) histidinol-phosphate aminotransferase
  KO
K00817  histidinol-phosphate aminotransferase [EC:2.6.1.9]
Organism
ain  Acidaminococcus intestini
Pathway
ain00340  Histidine metabolism
ain00350  Tyrosine metabolism
ain00360  Phenylalanine metabolism
ain00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ain00401  Novobiocin biosynthesis
ain01100  Metabolic pathways
ain01110  Biosynthesis of secondary metabolites
ain01130  Biosynthesis of antibiotics
ain01230  Biosynthesis of amino acids
Module
ain_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:ain00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    Acin_0994 (hisC)
   00350 Tyrosine metabolism
    Acin_0994 (hisC)
   00360 Phenylalanine metabolism
    Acin_0994 (hisC)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Acin_0994 (hisC)
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    Acin_0994 (hisC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ain01007]
    Acin_0994 (hisC)
Enzymes [BR:ain01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.9  histidinol-phosphate transaminase
     Acin_0994 (hisC)
Amino acid related enzymes [BR:ain01007]
 Aminotransferase (transaminase)
  Class II
   Acin_0994 (hisC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AEQ22222
UniProt: G4Q6S3
Position
1031512..1032033
Genome map
AA seq 173 aa AA seqDB search
MVIIDEAYHYFYKKTFLNFINMYDNIVILRTFSKLFSLAACRLGVIIGNPKLIHYVTNAK
LTFDVNSIALLFGEKILDHPDIIENLIQIENAGKQYALSQLKEHGYDSRDCRGNFIFVKP
KHDANEVARRLEQEKDILVHAYSNELLKDYLRVSVGSVTAMRFFLEGFFEIDR
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
ttggttattattgatgaagcctatcattatttttataagaaaactttcttgaacttcatc
aacatgtacgacaacattgtgattttacgtactttctcaaaactattttcactggcagcc
tgtcgcttaggcgttattattggaaatcccaaattaattcattatgtgacgaacgccaag
cttacatttgatgtaaattccattgcgcttttattcggagaaaaaattttagatcatcct
gacatcattgaaaatctgattcaaattgaaaatgctgggaaacagtatgcgttgagtcaa
ttaaaagaacatggttatgatagtcgtgattgccggggtaactttatctttgtaaaacct
aaacatgatgcaaatgaagtcgctagacgactcgaacaggaaaaggatattcttgttcac
gcttatagcaacgagctgcttaaagattatcttagagtatctgttggttctgtcacagcg
atgcgtttctttttagaaggcttttttgaaatcgatagataa

DBGET integrated database retrieval system