KEGG   Acidaminococcus intestini: Acin_1482Help
Entry
Acin_1482         CDS       T01639                                 

Gene name
pgk
Definition
(GenBank) phosphoglycerate kinase
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ain  Acidaminococcus intestini
Pathway
ain00010  Glycolysis / Gluconeogenesis
ain00051  Fructose and mannose metabolism
ain01100  Metabolic pathways
ain01110  Biosynthesis of secondary metabolites
ain01120  Microbial metabolism in diverse environments
ain01130  Biosynthesis of antibiotics
ain01200  Carbon metabolism
ain01230  Biosynthesis of amino acids
Module
ain_M00002  Glycolysis, core module involving three-carbon compounds
ain_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ain00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acin_1482 (pgk)
   00051 Fructose and mannose metabolism
    Acin_1482 (pgk)
   00562 Inositol phosphate metabolism
    Acin_1482 (pgk)
Enzymes [BR:ain01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     Acin_1482 (pgk)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Acin_1482 (pgk)
Exosome [BR:ain04147]
 Exosomal proteins
  Proteins found in most exosomes
   Acin_1482 (pgk)
  Exosomal proteins of colorectal cancer cells
   Acin_1482 (pgk)
  Exosomal proteins of bladder cancer cells
   Acin_1482 (pgk)
  Exosomal proteins of melanoma cells
   Acin_1482 (pgk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGK TIM QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AEQ22701
UniProt: G4Q2P5
Position
complement(1508038..1509963)
Genome map
AA seq 641 aa AA seqDB search
MEKKTVRDINVKGKKVLVRVDYNVPMNDKGEITDTIRIDATLPTLNYLLDQGAAIILMAH
LGRPKGKVVPSMSLKPCAEYLSQVMKKEVKFAPDCIGPEATEAARELQPGEILMLENLRF
HPEEEKNDMAFAASLASLADIYVNNGFGVSHRAHASVEGVAHYLPAVSGFLLEKEIKYLG
NAVDHPVRPFAAIVGGAKVADKIGVIRSLIEKADIILIGGGMANTFLAAQGYDLGKSLVE
KESIDVAKELIALAKEKNKKMLLPIDLEMAASFSADSEHASQTLDQLNPEWMALDIGPKT
AQLYADTLKNCKTIVWNGPMGVFEMAPFAAGTRRVAEAMADNEGITIVGGGDSAAAVKHM
GLDSRMKHVSTGGGASLEYLEGKVLPGVAALDDLRDPMVAGNWKCNKTVEEAMELAHTLM
HTTEQANCEIVLFPPFTALESVAATVEGSHLGYGSQDLFYMDQGAFTGAVSGPMIAEIGS
EYSIVGHSERRTYFGDTDAIVVKKVQACYRNGLDPVLCVGENEEERTEGRTESTILSQLL
PVLAVLTDDEARRLVVAYEPLWAIGTGKTASVEDALAVSAIIRRAVEERFNHETSRRVRV
LYGGSVTAENAHAFHQPGIDGVLVGGASLSAESFAAICNTF
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagaaaaccgtaagagatatcaatgtcaaagggaaaaaggtcctcgtccgcgtg
gactataacgtccctatgaatgacaagggggaaatcaccgataccattcgcatcgatgct
accctgccgacgctgaactacctcctagaccaaggggccgccatcatcttgatggcgcac
ctgggccgtccaaaagggaaggttgttccgtccatgagcctcaaaccctgcgcggaatac
ctgtcccaggtcatgaaaaaagaagtgaagtttgctccggactgcattggtcccgaagca
accgaagctgcccgtgaactgcagcccggcgaaatcctcatgctggaaaacctgcggttc
catccggaagaagaaaagaacgatatggcttttgccgcatccctggcttccttagccgac
atttatgtcaacaacggctttggtgtgtcccaccgggcccacgcttccgtagaaggggtt
gcccactatttgccggctgtatcgggtttccttctggaaaaagaaatcaagtacctcggc
aatgccgtcgatcatccggtccgtccttttgccgccatcgtcggcggtgctaaggtggca
gataagatcggtgtcatccgcagccttattgaaaaagcggatatcatccttattggcggc
gggatggccaataccttcctggctgcccaagggtacgacttgggaaaatcccttgtcgaa
aaagaaagcattgacgtggccaaagagctcatcgcccttgccaaggaaaaaaataagaag
atgctgcttccgattgaccttgaaatggcggcttctttctcggccgacagtgaacatgct
tcccagaccttggatcagctcaatccggaatggatggcccttgatattggacccaagaca
gcacagctgtatgccgataccttgaagaactgcaagaccatcgtctggaacggaccgatg
ggtgtctttgaaatggcgcctttcgctgccggtacgcgccgtgtagccgaagctatggcc
gataacgaaggcatcactatcgtcggcggcggtgacagtgcggctgctgtcaagcacatg
ggtcttgacagccggatgaagcatgtgtcgacaggcggcggtgcttcccttgaatatctt
gaagggaaggtgcttcctggcgttgctgccttggatgatctccgggaccctatggtggcc
ggaaactggaaatgtaataagaccgtggaagaggccatggaattggcccataccttgatg
cataccacggaacaggcaaattgtgaaatcgttcttttcccgccctttacggctcttgaa
tctgtagcggcaacggtggaaggatcccatctgggatatggttcccaggacctgttctac
atggatcaaggcgctttcactggcgcagtttccggcccgatgattgccgaaattggttcc
gaatattccatcgtaggccattccgaacggagaacttactttggggatacagatgcgatt
gtggtcaagaaggtccaggcctgctatcgaaatggtctcgatcctgttctctgcgttggc
gagaacgaagaggaacggacggaaggccgtacggaaagtacaatcttaagccagctccta
ccggttcttgccgtcttgactgacgacgaggcacgccgactcgtcgttgcttatgaaccg
ctctgggccattggcacgggcaagacggcatccgtagaagatgctcttgctgtcagtgcc
atcattcgccgcgccgttgaagaacggttcaatcatgaaacaagccgccgtgtccgtgtc
ctttatggcggttccgtaacggccgaaaatgcgcatgccttccatcagcctggtattgat
ggcgttcttgttggcggggccagcctctcggctgaatcctttgccgccatctgcaatacg
ttttga

DBGET integrated database retrieval system