KEGG   Acidaminococcus intestini: Acin_2217Help
Entry
Acin_2217         CDS       T01639                                 

Gene name
pfk
Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
ain  Acidaminococcus intestini
Pathway
ain00010  Glycolysis / Gluconeogenesis
ain00030  Pentose phosphate pathway
ain00051  Fructose and mannose metabolism
ain00052  Galactose metabolism
ain00680  Methane metabolism
ain01100  Metabolic pathways
ain01110  Biosynthesis of secondary metabolites
ain01120  Microbial metabolism in diverse environments
ain01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ain00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acin_2217 (pfk)
   00030 Pentose phosphate pathway
    Acin_2217 (pfk)
   00051 Fructose and mannose metabolism
    Acin_2217 (pfk)
   00052 Galactose metabolism
    Acin_2217 (pfk)
  Energy metabolism
   00680 Methane metabolism
    Acin_2217 (pfk)
Enzymes [BR:ain01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Acin_2217 (pfk)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Acin_2217 (pfk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AEQ23413
UniProt: G4Q6C3
Position
complement(2238469..2239569)
Genome map
AA seq 366 aa AA seqDB search
MAEKRGTLAVLTGGGDCPGLNAVIRAVVKTAVTHGYEIYGIRNGFHGLIQDDMKKMSMAD
VSGILPRGGTVLGTTNRDNPFHYAAGEDAAGNVIYEDRRDDVVRNLNAHGIECLIVIGGD
GSLKIGYDLHRFCGVNVVGVPKTIDNDLPGTERTFGFDTAMAMATEALDRLHTTAESHHR
VMVLEVMGRYAGWIALHSGLAGGADVILIPEIPYRIESVIEKVKARQAQGKQFSIIVVAE
GSKPVGGKMTVARLVKNSFEQVRLGGVGNKLADEIEAKTGIEARCTILGYLQRGGSPTAF
DRVLSTRYGSAAVEACLAGAYNVMVALSSGEIVRIPIEEVAGKPHQVPLDSDLIRAGRNL
GISFGD
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaaaagaggaaccctggcagtccttacgggaggcggtgactgccctggcctc
aatgccgtcatccgtgccgtcgtgaagacggccgtgacccatggctatgagatctatggc
attcgcaacggcttccatgggcttatccaggatgatatgaaaaaaatgtccatggcggat
gtatcgggtatcctgccgcgcggcgggacggtacttggtacaacaaacagggataatccc
ttccattatgcggctggtgaagatgcagcaggcaatgtcatttatgaggatcggcgcgat
gatgtcgtaagaaaccttaacgcccatggcatcgagtgcctcattgtcattggcggcgat
ggaagcctcaagattggctatgacctgcaccgtttctgcggggtcaatgtcgtcggcgtt
cccaagaccattgataatgacctgccggggacggagcgaacctttggttttgacacagcg
atggcgatggctacagaggcattggaccgccttcataccacggcagaatcccatcaccgc
gtcatggtccttgaagtcatggggcgctatgcggggtggattgcccttcattccggcctt
gccggcggagcggatgtaatcttgatcccggaaatcccctaccggatcgagtctgtcatt
gagaaggtcaaggcccgtcaggctcaaggaaagcaatttagtatcattgttgttgccgaa
gggtccaaaccagtgggcggtaagatgacggtcgcccgtctcgtgaaaaatagctttgaa
caggtgcgcctgggcggcgtgggcaataaacttgccgacgaaatcgaggcgaagacgggt
atcgaagctcgctgtacaatcttgggctatctccagcgcggcggttcgccgactgccttt
gaccgtgtcctgtcgactcgttatggctcggctgccgtggaagcctgccttgccggggcc
tataatgtgatggttgccctgtccagtggggagattgtccgcatcccaatagaagaagta
gcgggaaaacctcatcaggtaccgcttgattcggatcttatcagggcagggaggaacctt
gggatttcctttggggattga

DBGET integrated database retrieval system