KEGG   Acidaminococcus intestini: Acin_2308Help
Entry
Acin_2308         CDS       T01639                                 

Gene name
nagA
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
ain  Acidaminococcus intestini
Pathway
ain00520  Amino sugar and nucleotide sugar metabolism
ain01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ain00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Acin_2308 (nagA)
Enzymes [BR:ain01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     Acin_2308 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: AEQ23500
UniProt: G4Q718
Position
2335326..2336468
Genome map
AA seq 380 aa AA seqDB search
MQAIINSKLILPHTVLTGQTLLFGTHIYDILPAGSPLPEGTESIDAKGAYLSPGFINMHI
HGCGGADTMDGTRTSMEILCRKLPKCGVTAFLPTTMTRVWPIVQKALRNVRKAMEVPCPG
SRVLGAYLEGPFISGSYRGSQKAEEIQAANMERIRPYCDVIKVLVIAPETLSSMAFIHSC
CKKGIIVSLGHSGATYEEASRAIKAGASHITHTFNAMSPLHHRKPGMVGAALTLPVTTEI
ISDGLHIHDAVLRLLVKVKGPDQIVIVTDSMRAAMEGDGISELGGQTVYVRGGRALLADG
TIAASVDTMEHSLHHFLKATGLPLADVIRMATVNPAKELGVYETMGSLEKGKLADMTIFD
EKFDVKMTFVGGERVYQKKG
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgcaagccatcatcaacagcaaacttattttaccacacaccgtccttacaggacagacg
ctcctttttggaacccatatctacgatattctcccggcaggcagccccttaccggagggt
acggaaagcatcgacgccaagggggcctatctctcgcctggcttcatcaatatgcatatc
catggctgcggcggggccgatacaatggatgggacccggacctccatggaaatcctctgc
cggaaacttccaaaatgcggcgttacggcatttttaccgacgacaatgacaagggtatgg
cccatcgttcaaaaggcgctcagaaacgttcgtaaggctatggaagtcccctgccccggc
agccgtgtcctgggggcctatttggaagggcccttcatttccggcagttaccggggatcg
caaaaagccgaggaaatccaagcggccaatatggagcggatccgcccttactgcgacgtc
atcaaagtccttgtcatcgccccggaaacactgtcttccatggcgtttatccattcatgc
tgcaaaaagggcatcatcgtttcccttggtcattccggtgcaacctatgaagaagccagc
cgggccatcaaggcaggggccagccacatcacccataccttcaacgccatgagtcccctt
catcaccgtaaacccggcatggtcggcgcggccctgacgcttccggtgacaacggagatc
atctcggatgggctgcacatccacgatgcggtcctgcgcctgttggtaaaagtcaagggg
ccggaccagattgtcattgtgaccgattccatgcgggctgccatggaaggcgacggcatc
agtgaactcggcgggcagacagtctatgtccgcggcggaagggcgcttctcgcggacggg
accattgcggcaagcgtcgacaccatggaacacagtctccatcatttcctgaaggctacg
ggcctacccctcgccgatgtcatccgcatggcaacggtcaatcccgccaaggagctgggc
gtctatgagacaatgggctcccttgaaaaaggcaaactggctgacatgaccatctttgac
gagaagtttgacgtgaagatgacctttgtgggtggggaaagggtgtatcagaaaaaagga
tga

DBGET integrated database retrieval system