KEGG   Actinobacillus indolicus: EXH44_03520Help
Entry
EXH44_03520       CDS       T05940                                 

Gene name
oadA
Definition
(GenBank) oxaloacetate decarboxylase subunit alpha
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
aio  Actinobacillus indolicus
Pathway
aio00620  Pyruvate metabolism
aio01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aio00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EXH44_03520 (oadA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:aio02000]
    EXH44_03520 (oadA)
Enzymes [BR:aio01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     EXH44_03520 (oadA)
Transporters [BR:aio02000]
 Other transporters
  Primary active transporters [TC:3]
   EXH44_03520 (oadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 Peptidase_M23 RnfC_N
Motif
Other DBs
NCBI-ProteinID: QBQ63371
UniProt: A0A4P7CJI0
Position
740592..742418
Genome map
AA seq 608 aa AA seqDB search
MTIQPKKIAITDVVLRDAHQSLFATRLRLDDMLPIAKELDEIGYWSLEAWGGATFDACIR
FLGEDPWVRLRELKKAMPKTPLQMLLRGQNLLGYRHYADDVVERFVDRSVANGMSVFRVF
DAMNDPRNMKCALQAVRKYGGHAQGTLSYTTSPVHTTQTWLDVTEQLLEIGIDSLVIKDM
SGILTPMAAYDLVKEIKSRYDVELHLHCHSTTGMAEMALLKAIEAGVDGVDTSISSMSGT
YGHPATEALVATLQSTPYDTGLDIPQLEKISSYFREVRKKYHAFEGQLKGVDSRILVAQV
PGGMLTNLESQLKQQNASDKLDLVLKEIPEVRKDLGYIPLVTPTSQIVGTQAVINVLMGE
RYKNIAKETAGILKGEYGRTPAPVNAELQARVLEGKAPITDRPADHLAPEVEKLTAEITA
QAKEKGIKLAENSIDDVLIVALFQQVGWKFLENRGNPDAFEPVPTKESAKPATPKAEKPA
TQATGSAVYTVELEGKAFVVKVSEGGDISNIAPVASPAPAQPVASVANSAPQPTACGNGE
PVNAPMAGNIIKVVVNEGQQVAEGDVLLILEAMKMETQICAAKAGTVQGIKVKAGDVVGV
GDALMQIA
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgactattcaaccgaaaaaaattgctattactgatgtggtattaagagatgcgcatcaa
tcattgtttgcgacacgtttacgtttagacgatatgttaccgatcgcaaaagaactcgat
gaaattggatattggtcattggaagcatgggggggagcaacgtttgatgcttgtattcgt
tttttaggggaagatccgtgggtgcgtttacgtgaattgaaaaaagcgatgccaaaaacg
ccattacaaatgctactgcgtggtcaaaatttattaggttatcgccattatgccgatgat
gtggttgaacgctttgtcgatcgctccgtggcaaacggcatgagtgttttccgtgtgttt
gatgcaatgaacgacccacgcaatatgaaatgtgcactacaagcggtacgaaaatacggc
ggacatgcacaaggaacgttaagttataccaccagccctgttcatacgacacaaacttgg
ttagatgtcaccgagcagttacttgaaatcggcattgattcattagtgattaaagatatg
tcgggaatcctcaccccaatggcagcctatgatttggtcaaagaaattaaatcccgttat
gatgtggaattacatctacactgccactccaccacaggcatggcagaaatggcattactc
aaagcgattgaagcaggcgtggacggtgtagatacgtctatttcatccatgagtggcact
tacggacaccctgcaaccgaagcgttagtagcaaccttacaaagcaccccttacgatacg
ggtttagatattccacaattagaaaaaatttcctcttatttccgtgaagttcgtaaaaaa
taccatgcgtttgaagggcaattaaaaggtgtagatagccgtattttagttgctcaagta
ccagggggaatgctcaccaaccttgaaagccagttaaaacagcaaaatgcgtccgataaa
ttagacttggtgttaaaagagatccctgaagtccgtaaagatctcggctatatcccgcta
gtcaccccaacatcacaaattgtcggtacacaagcggtgattaacgtacttatgggtgaa
cgctataaaaatattgcgaaagaaacagcgggcatcttaaaaggtgaatacggacgcaca
cctgcaccggtcaatgccgaattacaagcccgagtgttggaaggcaaagcgccgattacc
gatcgcccagccgatcaccttgcgcctgaagtcgaaaaattaacggctgaaattaccgct
caagccaaagaaaaaggtattaaattagccgaaaacagtattgatgatgtgttgattgtt
gcgctcttccaacaagtcggttggaaattcttagaaaatcgtggcaatccagatgctttt
gaaccagttccaacgaaagaaagtgctaaaccagcgacaccaaaagcagaaaaaccggca
acacaagcgaccggttctgcagtttacaccgttgaattagaaggcaaagcttttgtggtg
aaagtcagtgaaggtggcgatatcagcaatatagctccggtagcctcccctgcaccagct
caacctgttgcctcagttgcaaattctgcgccacaaccaaccgcttgtggtaacggcgag
ccagtcaatgcaccaatggcaggaaatatcattaaagttgtagtaaatgaaggacagcaa
gtcgcagaaggtgatgtattactcatccttgaagcgatgaaaatggaaacccaaatctgc
gcagcaaaagccggaacagtacaaggtattaaagtgaaagcaggtgatgtcgtcggcgta
ggcgatgcgctgatgcaaatcgcctag

DBGET integrated database retrieval system