KEGG   Actinobacillus indolicus: EXH44_04425Help
Entry
EXH44_04425       CDS       T05940                                 

Gene name
nagA
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
aio  Actinobacillus indolicus
Pathway
aio00520  Amino sugar and nucleotide sugar metabolism
aio01100  Metabolic pathways
aio01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:aio00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    EXH44_04425 (nagA)
Enzymes [BR:aio01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     EXH44_04425 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: QBQ63535
UniProt: A0A4P7CHJ4
Position
complement(923862..925013)
Genome map
AA seq 383 aa AA seqDB search
MSRYALMNGVIYTGSEVLYQHAVIINDDKIEKIVHQQELTEDLFQIDLEGANLSAGFIDL
QLNGCGGVTFNEDISVKTLEIMQETNLKSGTTSYLPTFITSPDEGMKQAVQVMREYLAKY
KNQALGLHLEGPYLSVAKKGVHRPEYIREISGEMLDFLCKNGDVITKLTLAADNPTADHI
QKFVDAGIIVSIGHSNATFAEAKRRIEQGIGFATHLHNAMSPISSGRDGGVVGAVLDSDI
YAGIIVDGLHVDWSNVRIAKKVKGDKLVIVTDAVAPAGTKDMEYFIFVGKKVWYKDGKCV
DEFGSLGGAAITMIESIRNMMQHTDLTLDEVLRMCTLYPARAIHVEDKLGSIEAGKIANL
AAFNSQFEVIGTAVNGQWKWSQL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgatatgctttaatgaacggtgtgatttacactggaagtgaagtgctatatcag
cacgctgtgattattaatgatgacaaaattgaaaaaattgtacatcaacaagagttaaca
gaagacctttttcaaattgatttagaaggtgcaaacctttctgcaggttttattgattta
cagttaaatggttgtggcggtgtaacatttaatgaagacattagtgttaaaacccttgaa
attatgcaagaaaccaacctgaaatcaggtacaacaagctacttgccgacctttattact
tcgccagatgaaggaatgaaacaggcagtgcaagtaatgcgtgagtatttggctaaatat
aaaaaccaagcactcggcttgcatttagaaggaccttatttaagcgtggcgaaaaaaggg
gtgcatcgtcctgaatatatccgtgaaataagcggtgagatgttggattttctttgcaaa
aacggtgatgttattacgaaattaacacttgcagcagataatccaacagcagatcatatt
cagaaatttgttgatgcaggcattattgtgtctattgggcattcaaatgcgacttttgca
gaagctaaacgacgtattgagcaaggcattggctttgccacccatttgcataatgccatg
tcgccgatcagctctgggcgtgatggtggcgtagtgggggcagtgttggatagcgatatt
tacgcaggcattatcgttgatggcttgcacgtggattggagtaatgtgcgtattgcgaaa
aaagtcaaaggcgataagttggtgattgtgaccgatgcggttgctccagctggtactaaa
gatatggaatattttatctttgtgggtaaaaaagtttggtacaaagacggtaaatgtgtc
gatgaatttggcagccttggcggtgcggcgatcacgatgatcgagtctattcgcaatatg
atgcaacatacggatctgacattagatgaagtacttcgtatgtgtaccctgtacccagcc
agagcgattcacgtagaagacaaactcggatctattgaagcgggcaaaatcgctaactta
gcggcgtttaatagccaatttgaagtgattggtactgcggtaaatggtcagtggaaatgg
agtcagctctaa

DBGET integrated database retrieval system