KEGG   Actinobacillus indolicus: EXH44_05100Help
Entry
EXH44_05100       CDS       T05940                                 

Gene name
rfaD
Definition
(GenBank) ADP-glyceromanno-heptose 6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
aio  Actinobacillus indolicus
Pathway
aio00540  Lipopolysaccharide biosynthesis
aio01100  Metabolic pathways
Module
aio_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:aio00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    EXH44_05100 (rfaD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:aio01005]
    EXH44_05100 (rfaD)
Enzymes [BR:aio01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     EXH44_05100 (rfaD)
Lipopolysaccharide biosynthesis proteins [BR:aio01005]
 Unusual sugar
  EXH44_05100 (rfaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind NAD_binding_4 Polysacc_synt_2 KR
Motif
Other DBs
NCBI-ProteinID: QBQ63651
UniProt: A0A4P7CK79
Position
1029202..1030128
Genome map
AA seq 308 aa AA seqDB search
MIIVTGGAGFIGSNIVKALNAIGRTDILVVDNLKNGEKFVNLVDLDIADYCDKEDFIASI
IAGDDFGEIDAIFHEGACSATTEWDGKYLMQNNYEYSKELLHFCLDRQIPFFYASSAATY
GGRSDNFIEERKFEQPLNVYGYSKFLFDEYVRKILPEAESPVCGFKYFNVYGPREQHKGS
MASVAFHLNTQILKGENPKLFEGSETFLRDFVYVEDVAQVNIWAWQNGISGIFNLGTGNA
ESFRAVADAVLAFHQKGQIETIPFPDHLKSRYQTFTQADLTKLRAAGYDKPFKTVAEGTK
AYMEWLNR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgattattgtaacaggcggtgctggctttatcggtagcaatattgttaaggcgttaaat
gctatcggtagaaccgatattttagtagttgataacctgaaaaatggtgagaagtttgtt
aatttagtcgatttagacattgcagattactgtgataaagaagattttattgcttctatt
attgctggcgatgattttggtgagattgatgcgattttccacgaaggggcttgttcagcc
acgacggagtgggacggtaaatacttaatgcaaaataactatgagtattctaaagagttg
ttgcatttctgtttagatcgccaaattcctttcttttatgcgtcaagtgcggcgacctac
ggcggtcgttcggacaactttattgaagagagaaaatttgaacagccgttaaatgtttat
ggctattctaaatttttgtttgatgaatatgtgcgtaaaattctgcctgaagcagagtcg
ccagtgtgtggctttaagtatttcaatgtgtatggcccacgcgaacagcataaaggctcg
atggcaagtgtggcgttccacttgaatacgcaaattctcaaaggcgaaaatccgaagtta
tttgaaggctcagaaacctttttgcgtgattttgtgtatgtggaagatgtggctcaggtg
aatatttgggcgtggcaaaatggaatttcgggtattttcaatctgggtacgggcaatgcg
gagtctttccgtgccgttgctgatgcggtgttggcgttccatcaaaaagggcaaatcgaa
actattccattcccagatcatttaaaatctcgttaccaaacctttacgcaagctgattta
accaaactgcgtgcagcaggttatgataagccgtttaaaaccgttgcagaagggactaag
gcttatatggagtggttaaatagataa

DBGET integrated database retrieval system