KEGG   Arachis ipaensis: 107605505Help
Entry
107605505         CDS       T04301                                 

Definition
(RefSeq) uncharacterized protein LOC107605505
  KO
K02890  large subunit ribosomal protein L22
Organism
aip  Arachis ipaensis
Pathway
aip03010  Ribosome
Brite
KEGG Orthology (KO) [BR:aip00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    107605505
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:aip03011]
    107605505
Ribosome [BR:aip03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    107605505
  Bacteria
    107605505
  Archaea
    107605505
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-GeneID: 107605505
NCBI-ProteinID: XP_016162883
Position
B06
AA seq 392 aa AA seqDB search
MMQQHYPILSNPSSHLHPIPLRWPEVRPASSQPTSFTKPASFTSHLATVFHRAHVASTSL
FAVAHLAGSPLRPLLTSPSLTFLPRHLSAFKIGGYLWRPRSPIPDARCGDGAGADYGLRL
FTKECIVIMVQWQRHFLPVFRQIAHSATTSSPQGKGLTTLTARTILLPSISIRSPVYHSF
QSQGISGSTCLLSKSSDLEQTPTSSPLALTSFLGSKEAQDQKQTPVKKERVQAVMSKIKQ
SPKKVNLVAALVRGMLVKDALLQLQVTVKRASRTVYQGITQAQGNAVNNHGLDAERLIVA
EAFVGKGLFRKKVSYHSKGRAGIKVKPECRLTVVVREITAEEEAKIARLKVHNFRKLTKR
EKRLVPHQLIVSNPVWGRKNKSSDRNSSATAA
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgatgcagcagcattaccccatcctctcaaaccctagcagccaccttcatcccattcct
ctccgttggccagaagttcggccggcatcgtcacagccgacgtcgttcaccaagcccgcg
tcattcacctctcacctcgccactgtctttcaccgagctcacgtcgcttccacttctctc
ttcgccgtcgctcacctcgccggctcgcctctccggcctctgcttacctcgccgtccctc
accttcctccctcgtcatctctctgcttttaaaataggcggatatctctggagaccccga
tccccgatccccgatgcccgatgcggggatggggcgggggcggactatgggctgcgtttg
tttacaaaagagtgcattgtaatcatggtccagtggcaaaggcatttcttgccagttttt
cgtcaaattgcacactctgctaccacctcatctccccaaggtaagggtctgacgacgttg
acagcaagaacaatactattgccctcaatttcaattcgtagccctgtttatcattctttc
caatcccagggaatttcgggttctacctgtttgctttctaagtcatcagatctggaacaa
acaccaacttcctccccgttagccttaacttcctttttgggtagcaaagaagctcaagac
cagaagcagacacctgttaagaaagaaagagttcaagcagtaatgtcaaaaataaagcag
agtcctaagaaggtcaacttggttgctgctttggttcgtggtatgctggttaaagatgca
ttgctgcaattgcaagtgacagtaaagcgagcttcaagaactgtatatcagggtattact
caagcccaaggaaatgccgtaaataatcatggattggatgcagagcgcctcattgttgcc
gaagcgtttgttggaaaaggattattccggaagaaagtttcttaccattccaaaggaaga
gccggcatcaaagtcaaaccggaatgcaggctaacagttgtagtaagagaaataaccgct
gaagaagaggcgaagattgcgaggttgaaggttcacaatttccgcaagctcacgaagcgt
gagaaacggcttgtgccgcatcagcttattgtgtccaatcctgtttggggccgcaaaaac
aaatctagcgatcgaaactcgagtgccactgctgcatga

DBGET integrated database retrieval system