KEGG   Arachis ipaensis: 107605751Help
Entry
107605751         CDS       T04301                                 

Definition
(RefSeq) vacuolar protein sorting-associated protein 41 homolog isoform X1
  KO
K20184  vacuolar protein sorting-associated protein 41
Organism
aip  Arachis ipaensis
Brite
KEGG Orthology (KO) [BR:aip00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aip04131]
    107605751
Membrane trafficking [BR:aip04131]
 Endosome - Lysosome transport
  Tethering complex
   Hops complex
    107605751
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin zf-RING_2 WD40 zf-RING_11 zf-RING_UBOX zf-RING_5 Presenilin
Motif
Other DBs
NCBI-GeneID: 107605751
NCBI-ProteinID: XP_016163208
Position
B06
AA seq 961 aa AA seqDB search
MAPIPSENGVEGDDEREEEEEEEEEEEEEEEEEEEEEEEEEAEEGEEEDDEEEPRLKYQR
MGGSIPALLSSDAASCIAVAERMIALGTHDGIVYILDFLGNQVKEFPAHSAVVNDLSFDL
EGEYIGSCSDDGSVVICGLFSDEKTKFEYHRPMKAIALDPDYTRNASRRFVAGGLAGNLY
LNSKTWLGYRDQVLHSGEGPIHAVKWRTSLVAWANNTGVKVYDTANNQRVTFIERPRDSP
RPELLLPHLVWQSDTLLVIGWGTTVKIASIRTNRYQVANGTYRNFPLSSMSQVDIVASFQ
TSYFISGIAPFDDALVVLAYVPGEDGEKDFSSTAPSRQGNAQRPEVRIVTWNNDELSTDA
LPVHGFEHYKAKDYSLAHAPFSGSSNAGGQWAAGDEPLYYIVSPKDVVIAKPRDTEDHIT
WLLQHGWHEKALAVVESSHGRSELLDEVGSRYLDHLIVERKYSEAASLCPKLLRGSASAW
ERWVFHFAHLRQLPVLVPYMPTENPRLRDSAYEVALNALATNPSFHKDLLSTIKSWPPVI
YSALSVISAIEPQLKTSSMTEPLKEALAELYVINGQHEKAVALYADLMKPEVFDFIDKHK
LHGAIREKVFQLMMIDCKRAVPLLIQAKNLISAPEVVKQLQNADNESDSRYFLHLYLHSL
FEVNPHAGRDFHDMQVELYADYDPKMLVPFLRNSQHYTLEKAYEICIRRDLIREQVFILG
RMGNSKQALAVIINKLGDIEEAVEFVTMQQDDDLWEELIQQCLNKPEMVGILLEHTVGNL
DPLYIVNKVPNGMEIPRLRDRLVKIITDFRTETSLRHGCNDILKADCVNLLVKYYKEAKQ
GICLTNEEDEPRAKRRGTNASHWKSSSFRTMEMNSKISRGGARCCICFDPFSIRDVSVIV
FFCCHAYHSTCLTDSSYTSSSKKESGVNNSDDNDNDDDDDDDELEVGGPRMRCILCTTAA
S
NT seq 2886 nt NT seq  +upstreamnt  +downstreamnt
atggctccgattccgtccgagaatggcgtcgaaggagatgacgagagagaagaagaagaa
gaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaagaa
gaagcagaagaaggagaagaggaagatgacgaagaggagccaaggctcaagtaccagaga
atgggaggaagtatacctgcgctgctatctagcgacgcagcttcttgcatcgccgtcgcg
gaacgcatgatcgcactcggtactcacgacggcattgtctacatcctcgatttcctcggc
aaccaggtgaaagagttccctgctcattctgctgttgttaacgaccttagctttgattta
gagggtgagtatattggaagctgttccgatgatggatcagttgttatttgcggtcttttt
tccgatgagaaaacgaagttcgagtatcatcggccgatgaaggcgattgccttggatcct
gattacacaaggaatgcctctaggagatttgttgcaggtggtttagctgggaatttgtat
ttgaattcgaagacatggttaggctatcgtgaccaggttttgcactctggggaaggtcca
atacatgcagtgaagtggcgaacgagtcttgttgcttgggcaaacaacacaggagtgaag
gtttatgatactgccaataaccagcgggtaacatttattgaaaggccaagagatagcccc
aggcctgagcttttgcttcctcacttggtttggcagagtgacaccctcttggttattggc
tggggaactactgtcaaaattgcttcaataagaacaaaccgctatcaagtagccaatggg
acatacagaaattttcctttgtctagtatgagccaggtggacattgtggcatcatttcaa
actagctatttcatctcaggaattgccccctttgatgatgctctggttgttctggcgtat
gttcctggagaagatggagaaaaggactttagtagcactgctccttctcggcagggcaat
gctcaaagaccagaggttcgaatagtaacatggaacaatgatgagctttcaacagatgct
ctaccagtacacggctttgagcattacaaggcaaaggactattctcttgctcatgctccc
ttctcaggtagcagtaatgctggtggtcagtgggctgcaggtgatgaaccactttattat
attgtgtccccaaaggatgtagttattgcaaagccaagggatactgaagatcatattact
tggcttcttcaacatgggtggcatgaaaaagctttggctgtagttgaatcaagtcatggg
agaagtgaacttcttgatgaggtgggatctagataccttgatcatttgatagtggaaaga
aaatattctgaagcagcttcattgtgtcccaagttgcttcgagggtcagcctcagcttgg
gaaagatgggttttccactttgctcaccttcgtcaactccctgttttggttccttacatg
cctacagaaaatcctagactgcgtgattctgcctatgaggttgctctaaatgcattggct
acaaatccttcctttcataaggatctcttgtccactattaagtcctggccacctgtaatt
tattctgcactatctgttatttcagctattgaacctcagcttaaaacttcatccatgact
gaaccactcaaggaggcattagcagaattgtatgtaattaatgggcaacatgagaaagct
gttgctttgtatgctgatcttatgaagccagaagtatttgacttcattgataaacataaa
ctgcatggtgcaattcgtgagaaggttttccaattaatgatgattgattgcaagcgtgct
gttcctctgttaatccaagctaaaaacttaataagcgctcctgaagttgtgaagcaactt
caaaatgctgataatgagtctgactcaagatacttcttgcatttatatctccattcatta
tttgaagttaatccacatgctgggagggactttcatgatatgcaggtagaactatatgca
gactatgatccaaagatgctggtaccttttcttcgaaacagtcaacattatacccttgag
aaggcttatgagatttgcataaggagagatctaattagagagcaagtcttcatcctagga
aggatgggaaactcaaagcaagctctagctgtaattataaataaactgggagacatagag
gaggctgtagagtttgtcaccatgcagcaggatgatgatctttgggaagaactaatccag
caatgccttaacaaacctgaaatggtgggcatactattggagcacacagttggaaacctc
gaccccctctacattgtaaataaggttcccaatgggatggaaatacctcggctaagggat
cggctggtaaaaattatcactgacttcaggactgaaacatcacttagacatgggtgcaat
gatatacttaaggcggactgtgtcaaccttttagttaagtattacaaagaggcaaagcag
ggaatatgtctaactaatgaagaagatgagccacgagcgaaaaggagaggtactaatgct
tcgcactggaaatcatctagttttagaaccatggaaatgaactcaaagatctctagggga
ggtgcaagatgttgtatatgttttgatcccttttctatacgtgatgtatcggtcattgtt
ttcttttgctgtcatgcttatcactcaacttgtcttacggattcttcctacactagcagt
agcaagaaagagagtggagtcaataatagtgatgataatgataatgatgatgatgatgat
gatgatgaactggaggttggtggccctcgaatgcgatgcatattgtgtactactgctgct
agttag

DBGET integrated database retrieval system