KEGG   Arachis ipaensis: 107606824Help
Entry
107606824         CDS       T04301                                 

Definition
(RefSeq) uncharacterized protein LOC107606824
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
aip  Arachis ipaensis
Pathway
aip00460  Cyanoamino acid metabolism
aip00500  Starch and sucrose metabolism
aip00940  Phenylpropanoid biosynthesis
aip01100  Metabolic pathways
aip01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aip00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    107606824
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    107606824
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    107606824
Enzymes [BR:aip01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     107606824
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_3 Glyco_hydro_3_C MafB19-deam
Motif
Other DBs
NCBI-GeneID: 107606824
NCBI-ProteinID: XP_016164325
Position
B07
AA seq 251 aa AA seqDB search
MVVLMMRIDSDVMMIGGYVIDVILRLRIICGEKCEFVMKKTSVYLIYGEPNNEEMENSHV
RGDMDATDMIEDKNVITFRGFLISNWERLDRLCHPHGSNYPYCIKSAVNAEIDMVMVGLQ
FEPFIEDLTFLVKSGKVPISRIDDAVEQILRVKFAAGLFEFPFSDRSLLDMVGCKQHRDL
AREAVRKSLVLLKDGKDISKPFLPLDRKAKRILVAGTHADDLGFQCGGWTKTWYGCSGRI
TIDLNATRTSK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggttgtgttgatgatgagaattgatagtgatgtaatgatgattggtggatatgtgata
gatgtgatattgagattgagaataatatgtggagaaaaatgtgaatttgttatgaagaag
acatcagtttatctcatatatggtgagccaaataatgaagaaatggagaacagccacgtc
agaggagatatggatgctactgatatgatagaagataagaatgttattacttttaggggc
tttttgatttctaactgggaaagacttgaccgtctttgccatcctcatggatcaaattat
ccctactgcattaaatctgctgtcaatgctgaaattgacatggtaatggtgggtttacaa
tttgaaccattcattgaagatttgacctttcttgttaaatcggggaaagtaccaataagc
agaattgatgatgctgttgagcaaattttgagagtgaagtttgccgctggtctttttgaa
tttccttttagtgacagatctttgctagatatggttggatgcaagcaacatagagatcta
gcacgcgaagcagttcgaaagtccttggttctgttgaaagatggaaaagatattagcaaa
ccctttcttccattggataggaaagcaaagagaatccttgttgctgggactcatgccgat
gatcttggatttcagtgtggaggttggaccaaaacttggtatggatgtagtgggaggatt
accattgatctaaatgccacaagaacttcaaaatga

DBGET integrated database retrieval system