KEGG   Arachis ipaensis: 107608071Help
Entry
107608071         CDS       T04301                                 

Definition
(RefSeq) nicotinamide/nicotinic acid mononucleotide adenylyltransferase isoform X1
  KO
K06210  nicotinamide mononucleotide adenylyltransferase [EC:2.7.7.1 2.7.7.18]
Organism
aip  Arachis ipaensis
Pathway
aip00760  Nicotinate and nicotinamide metabolism
aip01100  Metabolic pathways
Module
aip_M00115  NAD biosynthesis, aspartate => NAD
Brite
KEGG Orthology (KO) [BR:aip00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    107608071
Enzymes [BR:aip01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     107608071
    2.7.7.18  nicotinate-nucleotide adenylyltransferase
     107608071
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTP_transf_like
Motif
Other DBs
NCBI-GeneID: 107608071
NCBI-ProteinID: XP_016165447
Position
B07
AA seq 246 aa AA seqDB search
MDIPLPVDKLALINNEPSPNTTNSKIYVVLVATGSFNPPTFMHLRMFELARDALNSEGYC
VIGAYMSPVNDAYKKKNLISAEHRMQLCNLACKSSDFVMVDPWEANQSTYQRTLTVLSRV
HSSICGKGLISRGTLKVMLVCGSDLIHSFSIPGFWIPDQVKSICRDYGIVCIRREGQDVE
KIISDDKILKENQANIKVVHDLVPNQISSTRLRDCIARGLSIKYLTADEVIDYIRDQKLY
LTLDDK
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggatattccgttgccggtggataaattagctttgatcaacaatgaaccctctccaaac
acaaccaacagtaagatatatgttgttcttgtcgctactgggagcttcaatccacctacc
ttcatgcatttgcgaatgttcgagcttgcaagagatgcactgaattcagaaggttactgc
gtaattggagcttacatgtctcctgtgaacgatgcatataagaaaaagaacctaatatct
gctgaacatcgaatgcaattatgtaatctagcatgcaaaagttcagactttgtaatggtt
gatccatgggaggcaaatcaaagcacctatcaacgcactttaaccgtgctgtccagagtc
cacagttcaatatgtgggaaaggattaatatctagaggaaccctcaaggtcatgcttgtc
tgtggttctgatctgattcattcttttagcattccaggattttggattcctgaccaggtt
aagagtatatgcagagattacggaatagtctgcattcgcagagaaggacaggatgttgag
aagattatatccgatgataaaattttgaaggagaatcaggctaatatcaaagttgtgcat
gaccttgtaccgaaccaaatcagttcaacgagattaagggactgcattgcaagaggatta
tcaataaaatacctgacagcagatgaagtgattgattatatcagagatcagaaattatac
ttaaccttggatgataaataa

DBGET integrated database retrieval system