KEGG   Arachis ipaensis: 107609718Help
Entry
107609718         CDS       T04301                                 

Definition
(RefSeq) heterodimeric geranylgeranyl pyrophosphate synthase small subunit, chloroplastic
  KO
K13789  geranylgeranyl diphosphate synthase, type II [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
aip  Arachis ipaensis
Pathway
aip00900  Terpenoid backbone biosynthesis
aip01100  Metabolic pathways
aip01110  Biosynthesis of secondary metabolites
Module
aip_M00366  C10-C20 isoprenoid biosynthesis, plants
Brite
KEGG Orthology (KO) [BR:aip00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    107609718
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:aip01006]
    107609718
Enzymes [BR:aip01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     107609718
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     107609718
    2.5.1.29  geranylgeranyl diphosphate synthase
     107609718
Prenyltransferases [BR:aip01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   107609718
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-GeneID: 107609718
NCBI-ProteinID: XP_016167219
Position
B07
AA seq 318 aa AA seqDB search
MVVGSMLHINGKPTVHFSCKSNHDRPSYIPKPTAVKMTTITTTTTITTAPSILQPYWASL
QADIEAHLKHVMPYKDPLVVFEPMHHLVFSAPRTTVPALCLAAGELLSGDRHQAMAAASA
LVLLLAANHTHEQIPSKPKSKPKPMSRPKSKTMSFRAFSPGIELMTGDGLIPFGFELLSG
SCDSVQENSDRVLRVIIEISRAMGSKGLIDAQYKKILLSESDGEESCHVERIMDIMEKNE
GGLHACGASCGAVLGGGSEEEIERLRKFGFYVGMIQGMVNEGFWEEVEVVKDLAFKELQY
FKDNNRDVDAISSFIIHV
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggtggttggttctatgctccacataaatggcaagccaaccgtccatttttcatgcaaa
tcaaatcatgatcgtccatcatacatacctaagcccacggcggttaaaatgacaacaatt
actactactactactattactactgctccctctatccttcaaccttattgggcttctttg
caggccgacattgaagcccatctcaaacatgtcatgccctataaagatccactcgtggta
ttcgagcccatgcaccatctcgtcttctcggcccctcgaaccaccgtgccggctctttgc
ctcgccgccggcgagcttctcagtggtgatcgccaccaagccatggcggcggcttctgcc
ttggtactcctccttgcagctaatcacacacatgagcaaattccaagcaagcccaagtcc
aagcccaagcccatgtccaggcccaaatccaagactatgagttttcgggcttttagtcct
ggtattgaacttatgacaggagatggtcttataccttttgggttcgagttgttgtctgga
tcctgtgactcggttcaagaaaattcggaccgggtcttgcgcgtgatcattgagatatca
cgcgccatgggatcaaaaggactgatagatgcccaatacaaaaaaattttattgagtgaa
tcggacggtgaggagtcatgccacgtggagagaatcatggacattatggagaaaaatgag
ggggggttgcatgcatgtggggcttcatgtggagcagtgttgggtggtgggagtgaagag
gaaattgaaaggttaagaaaatttggattttatgttggaatgatccaaggaatggttaat
gagggattttgggaagaagtggaagtggtaaaagatttggcattcaaggaattgcagtat
ttcaaggataataatagagatgttgatgcaatttctagcttcattattcatgtttag

DBGET integrated database retrieval system