KEGG   Arachis ipaensis: 107610605Help
Entry
107610605         CDS       T04301                                 

Definition
(RefSeq) (+)-gamma-cadinene synthase-like
  KO
K15803  (-)-germacrene D synthase [EC:4.2.3.75]
Organism
aip  Arachis ipaensis
Pathway
aip00909  Sesquiterpenoid and triterpenoid biosynthesis
Brite
KEGG Orthology (KO) [BR:aip00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    107610605
Enzymes [BR:aip01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.75  (-)-germacrene D synthase
     107610605
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Terpene_synth Terpene_synth_C
Motif
Other DBs
NCBI-GeneID: 107610605
NCBI-ProteinID: XP_020963795
Position
B08
AA seq 386 aa AA seqDB search
MSLTPLIIKTLVSFTVSKSKPTTMSLAPSSELKRPCANFAPNIWQDIFIQYADSQSLEVN
ETMKQEVQIHKEKIMLYLSSNDNSILQKLSLIDSIQRLSISYHFEREVDKALEEIYNNFT
NNSLPIEDYDLHFIALLFRLFRQNGYHISSDVFIKFKNIKGDFDEINVLQNVEEIWSLYE
VAQLRIHGEDILEEAHKFTCNKLKSFIDQLSPCLADQINRSLRLPLHKTVSRIRARSYMS
FYKENPSHNKVLLSLAKLDFNQPVQSVTQQLNQFFFLNGELLIISLAKNYRLPIFFLICI
LTCIGIIISFRWCKKLAFATKVIYARDRVVEAFFWPLTMSSEPKYSTWRLILGKLLACIC
LLDDTFDAFGTFEELQLLTEAIKRLI
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgtctcttacaccattgatcattaagaccttagtttcctttaccgtatctaagtcaaag
ccaacaacaatgtctcttgcaccatcttctgagttgaagcgaccttgtgcaaattttgct
cctaacatttggcaggatattttcattcaatatgctgattcacaatcattggaagtcaat
gaaactatgaagcaagaggtccaaatacacaaagaaaaaataatgctatatttgtcttcg
aatgacaatagcattttacagaaattaagtttaattgactcaattcaacgtttgagtata
tcttatcattttgaacgtgaagttgataaagcgttggaagaaatctacaataattttacc
aacaatagtcttcctatagaagattatgaccttcactttattgccttactctttcgtttg
ttcagacaaaatggatatcatatttcatcagatgttttcatcaaattcaagaatatcaaa
ggagacttcgatgaaataaatgttcttcaaaatgttgaagaaatatggagcttgtatgaa
gttgcacaattaaggattcatggagaagatatattggaggaagcacataaattcacatgc
aataaacttaagtccttcatcgatcaactgagtccatgtcttgcagaccaaatcaatcga
agcttaaggctgcctcttcacaagacagtttcaaggatacgagcaagatcatatatgtca
ttttacaaagaaaatccttcccataacaaagttcttctatctcttgcaaaattagatttc
aatcaaccggttcaatcagtaacccaacagttaaaccaatttttttttttaaacggtgag
ttattgattatttcattggctaaaaattatcggttaccaatatttttccttatttgtata
ttgacttgtattggtattattatttcattcaggtggtgcaaaaaattagcctttgcgaca
aaggttatttatgctagagatagggtggttgaggcattcttttggccactaaccatgtct
tctgagccaaaatatagtacttggagattgatattaggcaaactgcttgcatgtatatgt
cttcttgatgatacttttgatgcctttggcacatttgaagagcttcaactcttgacagag
gcaatcaaaaggttgatttga

DBGET integrated database retrieval system