KEGG   Arachis ipaensis: 107611521Help
Entry
107611521         CDS       T04301                                 

Definition
(RefSeq) serine decarboxylase-like
  KO
K01590  histidine decarboxylase [EC:4.1.1.22]
Organism
aip  Arachis ipaensis
Pathway
aip00340  Histidine metabolism
aip01100  Metabolic pathways
aip01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aip00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    107611521
Enzymes [BR:aip01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.22  histidine decarboxylase
     107611521
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 107611521
NCBI-ProteinID: XP_016168922
Position
B08
AA seq 430 aa AA seqDB search
MLSSGEEENHIEIQESNNDEHHSLAITNYTGEARHDLSASINRFVETLNHFNLRNLGYPA
NQELKYDGLGALLNYHINNAGDPFKGSSFCLNSSEFEVCVLDWFAKLWQIQKGHYWGYVT
TGGTEGNLHGILIGREQLPDGILYTSQDSHYSIFKIARMYRMQCVKVATLISGEIDCNDL
KALLLVHRNKPAIINLNIGTTMKGGVDDLDLVIQTLEECGFTSDRFYIHCDGALFGVMLP
FLMKAPKITFQKSIGSVTISGHKFLGCPIPCGVVITRLKYINNALSKDVEIIGSRDATIT
GSRCGHAPIFLWYCLKSKGLKGLKKDVEKCIMNASYLHGRLRGAGIGAMLNEFSNIVVFE
RPQLNDDFIRRWSLACEGKIAHVVVMQHVTTKMLDSFVSEFLQRRFQAQCIADHVGSSNC
SCSMHDGFLH
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgctctcatcaggagaagaagagaaccatattgaaatccaagagagtaataatgatgaa
caccacagtcttgccatcaccaactacaccggagaggcacgacatgatttgagtgcatca
attaatcgcttcgtggagactctaaatcacttcaacttgcgcaatttggggtaccctgct
aatcaagagttgaagtatgatggattgggagcattgcttaattatcacataaacaatgca
ggagatccatttaaagggagcagcttttgtctaaactcatcagaattcgaagtgtgcgtg
cttgattggtttgcaaagttatggcagatacagaagggtcactactggggatacgtcact
accggtgggactgaaggaaatcttcatggcattttaatagggagagaacaacttccagat
ggaattctatatacttcacaggattcacattattcaatattcaaaatagcaagaatgtat
cgaatgcaatgcgtgaaggttgccactttgatctctggtgagattgattgcaatgatcta
aaggctttactacttgttcacaggaataagccagccatcatcaatcttaacatagggaca
actatgaaaggaggagttgacgaccttgatcttgtaatacaaacacttgaagaatgtggt
ttcacttctgatcgattctacattcactgcgatggagcattgtttggagtgatgctgcct
tttctcatgaaagcaccaaagattaccttccagaaatccattggaagtgtaactatttct
ggccataagttcttgggatgtccaattccatgtggtgttgtaataactcgtttgaaatac
atcaataatgccctatccaaggatgttgaaatcattggttcaagggatgctacaataaca
ggtagccgttgtggacatgcccctatcttcctttggtattgtctgaaaagcaaaggatta
aaagggcttaagaaagacgttgagaagtgcataatgaatgcaagttacttacatggtcga
ttgcgtggtgctggcattggtgcaatgttgaatgagtttagtaacatcgttgtgtttgag
aggcctcaattaaatgatgactttattcgtaggtggagtttggcgtgcgaagggaaaatt
gcgcacgttgttgtcatgcagcacgtgaccactaaaatgcttgactcttttgttagtgag
tttcttcagagaaggtttcaggctcagtgcattgcagaccatgttggttcctcaaattgt
tcttgttcgatgcatgatggttttcttcattga

DBGET integrated database retrieval system